(data stored in ACNUC7421 zone)

EMBL: CP001825.PE172

CP001825.PE172       Location/Qualifiers
FT   CDS             complement(184034..185419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0174"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="PFAM: KaiA binding; KEGG: bxe:Bxe_B0484 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41096"
FT                   /db_xref="GOA:D1CDU0"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU0"
FT                   /inference="protein motif:PRIAM:2.7.11.1"
FT                   /protein_id="ACZ41096.1"
FT                   /translation="MDKISTGIPGFDVLLGGGIPKGSFVLVGGPPGVGKTILVTQMAFH
FT                   HASQGKKVVMLTALTETNAKLIAHLSTLAFFDDALLGNTLQILNIQKLLQEEGLDKTLA
FT                   EIRSTVIEQGVELLVIDSFRSLFTLTGDAAAVQNFIFNLSSALFMLGCTTLMVEDQYRM
FT                   DGFIHPEQAISDTIIHLSLSSLNSSATRKIEVLKMRGGDPIPGKHYFEITPSGIAIYPR
FT                   IESLASKVWPCDTNKRVSWGVAGLDEITGGVPVCSSNLVLGPLGVGKSLLSLQFLAAGI
FT                   REGQRVLFATFYDTLEDLSRRLSSVGVDLEDALNKGNVIAIQFPFSDISADKLVHQIIS
FT                   QLPESSSSRLVIDGFEVVREELDRDGRFMPFVGALAQIMRSRNVTTLITCGDKSMSLWA
FT                   ASPEWAPMDNVLTMDRINLSGELRRVLTIVKMRGIEHDNTVYEFTITPTGIEIKDKVEE
FT                   IGR"
     MDKISTGIPG FDVLLGGGIP KGSFVLVGGP PGVGKTILVT QMAFHHASQG KKVVMLTALT        60
     ETNAKLIAHL STLAFFDDAL LGNTLQILNI QKLLQEEGLD KTLAEIRSTV IEQGVELLVI       120
     DSFRSLFTLT GDAAAVQNFI FNLSSALFML GCTTLMVEDQ YRMDGFIHPE QAISDTIIHL       180
     SLSSLNSSAT RKIEVLKMRG GDPIPGKHYF EITPSGIAIY PRIESLASKV WPCDTNKRVS       240
     WGVAGLDEIT GGVPVCSSNL VLGPLGVGKS LLSLQFLAAG IREGQRVLFA TFYDTLEDLS       300
     RRLSSVGVDL EDALNKGNVI AIQFPFSDIS ADKLVHQIIS QLPESSSSRL VIDGFEVVRE       360
     ELDRDGRFMP FVGALAQIMR SRNVTTLITC GDKSMSLWAA SPEWAPMDNV LTMDRINLSG       420
     ELRRVLTIVK MRGIEHDNTV YEFTITPTGI EIKDKVEEIG R                           461
//

If you have problems or comments...

PBIL Back to PBIL home page