(data stored in ACNUC7421 zone)

EMBL: CP001825.PE174

CP001825.PE174       Location/Qualifiers
FT   CDS             complement(186231..187817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0176"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class I (M); KEGG: metS; methionyl-tRNA
FT                   synthetase protein; K01874 methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41098"
FT                   /db_xref="GOA:D1CDU2"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU2"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ACZ41098.1"
FT                   /translation="MSGSRYYITTAIPYVNAKPHIGFALELVQTDVLARYHRLIGDDTR
FT                   FLTGTDDNALKNVQAAEAEGISTKELVDRNAELFKALREPLAVSFDDFIRTSGEKRHID
FT                   GVQKLWRACQRSGDIYKRVYKGLYCVGCEQFYSEEELVNGLCPEHLTRPELVEEENYFF
FT                   RLSKYTDRLISIIESGELRILPETRRNEVLSFIRRGLEDFSISRASSRARGWGIPVPDD
FT                   PDQVMYVWFDALGNYITALDYAYDGELYRRYWLENPHRTHVIGKGILRFHAVYWPAMLL
FT                   SAGEPLPTTIYVHEYLTINGQKISKSLGNVIDPISIVERFGTDALRYWFVREVSRTEDT
FT                   DFTWDRLVTRYNADLANDLGNLLNRTVSMIRRYREGKVPSPSDSTDLEQDLRQIAEGIP
FT                   EKIYKYLDEFDLRAAITAIWDLVTRANRYVEESAPWLLARQEKNGDGAASSRLDTVLYS
FT                   LAESLRVIAVHLSPFLPLTSSKILEQLGIGADSQTKWPDVAAWGGLQPGTLVGEPKPIF
FT                   PRVELTTSEIS"
     MSGSRYYITT AIPYVNAKPH IGFALELVQT DVLARYHRLI GDDTRFLTGT DDNALKNVQA        60
     AEAEGISTKE LVDRNAELFK ALREPLAVSF DDFIRTSGEK RHIDGVQKLW RACQRSGDIY       120
     KRVYKGLYCV GCEQFYSEEE LVNGLCPEHL TRPELVEEEN YFFRLSKYTD RLISIIESGE       180
     LRILPETRRN EVLSFIRRGL EDFSISRASS RARGWGIPVP DDPDQVMYVW FDALGNYITA       240
     LDYAYDGELY RRYWLENPHR THVIGKGILR FHAVYWPAML LSAGEPLPTT IYVHEYLTIN       300
     GQKISKSLGN VIDPISIVER FGTDALRYWF VREVSRTEDT DFTWDRLVTR YNADLANDLG       360
     NLLNRTVSMI RRYREGKVPS PSDSTDLEQD LRQIAEGIPE KIYKYLDEFD LRAAITAIWD       420
     LVTRANRYVE ESAPWLLARQ EKNGDGAASS RLDTVLYSLA ESLRVIAVHL SPFLPLTSSK       480
     ILEQLGIGAD SQTKWPDVAA WGGLQPGTLV GEPKPIFPRV ELTTSEIS                    528
//

If you have problems or comments...

PBIL Back to PBIL home page