(data stored in ACNUC7421 zone)

EMBL: CP001825.PE176

CP001825.PE176       Location/Qualifiers
FT   CDS             complement(189483..190748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0178"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   sus:Acid_7201 peptidase M16 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41100"
FT                   /db_xref="GOA:D1CDU4"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU4"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ACZ41100.1"
FT                   /translation="MPEQYKDVLPNGLTVLGERLEGVRSLALGFIVGAGSSYDPDDKSG
FT                   LAHFTETMLLEGTTNRTSRQISDSLDSLGVSYGTSLDAETIGLSGVMVSSRLEPALEIF
FT                   ADILQNPSFPEDEMEQTRSSILQELRREEDEPMVKVRDLLRRVYYEGHPYSKRPTGEPD
FT                   VISSLSSADLREYHASYFNPANTVCAAAGDLDWDLFRSLVEKFLGGWKPGTKAPEIGPP
FT                   HPRPQLYVENQQTQQEHIAGAAPSVPFGHDDYYAAIIAAEILGGGMSSRLFVEVREKRG
FT                   LVYSVGASYSPGRYQGSWRIYAGTTPERASQTYSVLMEELHKLDSEGVSEEEFRRFQAL
FT                   TRSHVLMAGESTSARLRSLLTSWWYEGRIKPLSYIRERIDAVTVDQVNKVVREWPLSSN
FT                   LVLCALGPSTKESLVGENVSKV"
     MPEQYKDVLP NGLTVLGERL EGVRSLALGF IVGAGSSYDP DDKSGLAHFT ETMLLEGTTN        60
     RTSRQISDSL DSLGVSYGTS LDAETIGLSG VMVSSRLEPA LEIFADILQN PSFPEDEMEQ       120
     TRSSILQELR REEDEPMVKV RDLLRRVYYE GHPYSKRPTG EPDVISSLSS ADLREYHASY       180
     FNPANTVCAA AGDLDWDLFR SLVEKFLGGW KPGTKAPEIG PPHPRPQLYV ENQQTQQEHI       240
     AGAAPSVPFG HDDYYAAIIA AEILGGGMSS RLFVEVREKR GLVYSVGASY SPGRYQGSWR       300
     IYAGTTPERA SQTYSVLMEE LHKLDSEGVS EEEFRRFQAL TRSHVLMAGE STSARLRSLL       360
     TSWWYEGRIK PLSYIRERID AVTVDQVNKV VREWPLSSNL VLCALGPSTK ESLVGENVSK       420
     V                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page