(data stored in ACNUC7421 zone)

EMBL: CP001825.PE178

CP001825.PE178       Location/Qualifiers
FT   CDS             complement(191896..192375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0180"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bce:BC2074 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41102"
FT                   /db_xref="GOA:D1CDU6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ41102.1"
FT                   /translation="MKIRRMMQEDIPSVRHVAEVTWHHTYKNIIPEHIRTEFLATAYSD
FT                   KSLNYRMRNNVLLVVEDAGHLVGFAEFTPLQDSSEVELSAIYILPSHQGKGIGTQLLQE
FT                   GIKNFPDAKVIKLRVESRNAPAKSFYLAKGFLPTREYTILIHGYSCEITEMEKHL"
     MKIRRMMQED IPSVRHVAEV TWHHTYKNII PEHIRTEFLA TAYSDKSLNY RMRNNVLLVV        60
     EDAGHLVGFA EFTPLQDSSE VELSAIYILP SHQGKGIGTQ LLQEGIKNFP DAKVIKLRVE       120
     SRNAPAKSFY LAKGFLPTRE YTILIHGYSC EITEMEKHL                              159
//

If you have problems or comments...

PBIL Back to PBIL home page