(data stored in ACNUC7421 zone)

EMBL: CP001825.PE179

CP001825.PE179       Location/Qualifiers
FT   CDS             192521..194788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0181"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: mmw:Mmwyl1_0214 glycoside hydrolase family 3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41103"
FT                   /db_xref="GOA:D1CDU7"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU7"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /protein_id="ACZ41103.1"
FT                   /translation="MTRDIKSLIAQMTLEEKASLCSGLGFWDTKPIERLGIPSIVMTDG
FT                   PHGLRKQVPGSQNFFDSVPATCFPTAATIACSWDRSLVREIGIALGEECQAEGVSVILG
FT                   PGVNIKRSPLCGRNFEYFSEDPFLSTELAASYIEGVQSQGVGTSIKHFAANNQEHRRMS
FT                   VNAIVDERTLREIYLASFEGAVKKSKPWTVMCAYNRLNGDYCSENHYLLTKVLREDWGY
FT                   EGLVVSDWGAVNERVKGLEAGLDLEMPGNGGVGDRKIIEAVCSGELSEEVLDRAVERIL
FT                   KLIFQAVDNRKENFRYDADAHHQLARKAARESMVLLKNDNSILPLRKEGTIAVIGAFAK
FT                   HPRFQGGGSSHVNPTRIDIPYDEIQKAVGDSARLLYSDGYQLGSDEVNQSLIEEARQIA
FT                   SQANVALIFAGLPENYESEGYDRVHMSMPRSHLELIQAVSESQPNTVVLLCNGAPVEMP
FT                   WLHDVPAVLECYLGGQAVGSAIADLLFGEASPCGKLAETFPQKLSDNPSYLNFPGEDDK
FT                   VEYREGIFVGYRYYDTKEIEPLFPFGHGLSYTTFEYSDLSVDKKSIKDNEVVNVQVTVK
FT                   NTGKFAGKEIVQLYVSDLASSVRRPEKELKGFEKVELQPGEEKTVNFTLDKRAFAYYNV
FT                   DLSDWYVETGEFEICVGRSSRDIVLTEIIHVDSTQVIPKRYHRNSLIGDLQEDPKAAAL
FT                   FNQMMQQGLANTPFASSGEFNSEMIMALLRYMPLRALVNFSGGAFSEDDLNNLLDQLNS
FT                   AS"
     MTRDIKSLIA QMTLEEKASL CSGLGFWDTK PIERLGIPSI VMTDGPHGLR KQVPGSQNFF        60
     DSVPATCFPT AATIACSWDR SLVREIGIAL GEECQAEGVS VILGPGVNIK RSPLCGRNFE       120
     YFSEDPFLST ELAASYIEGV QSQGVGTSIK HFAANNQEHR RMSVNAIVDE RTLREIYLAS       180
     FEGAVKKSKP WTVMCAYNRL NGDYCSENHY LLTKVLREDW GYEGLVVSDW GAVNERVKGL       240
     EAGLDLEMPG NGGVGDRKII EAVCSGELSE EVLDRAVERI LKLIFQAVDN RKENFRYDAD       300
     AHHQLARKAA RESMVLLKND NSILPLRKEG TIAVIGAFAK HPRFQGGGSS HVNPTRIDIP       360
     YDEIQKAVGD SARLLYSDGY QLGSDEVNQS LIEEARQIAS QANVALIFAG LPENYESEGY       420
     DRVHMSMPRS HLELIQAVSE SQPNTVVLLC NGAPVEMPWL HDVPAVLECY LGGQAVGSAI       480
     ADLLFGEASP CGKLAETFPQ KLSDNPSYLN FPGEDDKVEY REGIFVGYRY YDTKEIEPLF       540
     PFGHGLSYTT FEYSDLSVDK KSIKDNEVVN VQVTVKNTGK FAGKEIVQLY VSDLASSVRR       600
     PEKELKGFEK VELQPGEEKT VNFTLDKRAF AYYNVDLSDW YVETGEFEIC VGRSSRDIVL       660
     TEIIHVDSTQ VIPKRYHRNS LIGDLQEDPK AAALFNQMMQ QGLANTPFAS SGEFNSEMIM       720
     ALLRYMPLRA LVNFSGGAFS EDDLNNLLDQ LNSAS                                  755
//

If you have problems or comments...

PBIL Back to PBIL home page