(data stored in ACNUC7421 zone)

EMBL: CP001825.PE180

CP001825.PE180       Location/Qualifiers
FT   CDS             194812..195408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0182"
FT                   /product="O-methyltransferase family 3"
FT                   /note="PFAM: O-methyltransferase family 3; KEGG:
FT                   scl:sce1553 O-methyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41104"
FT                   /db_xref="GOA:D1CDU8"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU8"
FT                   /inference="protein motif:PFAM:PF01596"
FT                   /protein_id="ACZ41104.1"
FT                   /translation="MDIKDYFASEPNTPEVLSKILVETDQLGFTMGSDVVTGSLLRALV
FT                   ASKPGGRFLEIGTGTGIATSWLLQGMDQDSILITLEKEDKFASIARKYLGNDPRVTFHL
FT                   VDAGTWLEQNQHEEFDLIFADSWPGKYSHLNEALSILKLGGIYVIDDMLPQPNWPEGHE
FT                   ASVRWLLNELASRSDLVIAKLACSTGLVLATKVTQ"
     MDIKDYFASE PNTPEVLSKI LVETDQLGFT MGSDVVTGSL LRALVASKPG GRFLEIGTGT        60
     GIATSWLLQG MDQDSILITL EKEDKFASIA RKYLGNDPRV TFHLVDAGTW LEQNQHEEFD       120
     LIFADSWPGK YSHLNEALSI LKLGGIYVID DMLPQPNWPE GHEASVRWLL NELASRSDLV       180
     IAKLACSTGL VLATKVTQ                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page