(data stored in ACNUC7421 zone)

EMBL: CP001825.PE181

CP001825.PE181       Location/Qualifiers
FT   CDS             195622..196911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0183"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bha:BH1864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41105"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDU9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ41105.1"
FT                   /translation="MLCRFKLHLFLVLALVVTACGGGGTASTPQQGSSGNQGKVTIRLS
FT                   TWAGVDESKELQAIIDKLNSKSNTYKIVHEPQPADYYTKLQTTISGGKGPDLMWLSQEY
FT                   VPGYAERGALMDLTQCVQEHSDKPAAKLDDYFESILDVGKFEGKLYALPWISQPVVLYY
FT                   NPKLFKEAGVEEPNENWTWDDFKAAAAKLTNPKKGIYGTAFNGWPPIQMFIWQAGGDVI
FT                   SEDLKHSPIDSPEAIQAEKFYQEIVYNPKYAAPENIIAEQGFADLAKNGKVAMFFGGAA
FT                   DDLDYAHAKDPKFAEMKAALVPKGPKSRTTFAWTGLMAINAKTANPEAACQALLDLTDG
FT                   IHHWKVLAPRKSLANKETIIQAVPEKAKSADVIIKAAQDMRTFRVVPQQSEWDTTFSEK
FT                   FLDPLFHRKGTPEELAKKVRPELEAILQGP"
     MLCRFKLHLF LVLALVVTAC GGGGTASTPQ QGSSGNQGKV TIRLSTWAGV DESKELQAII        60
     DKLNSKSNTY KIVHEPQPAD YYTKLQTTIS GGKGPDLMWL SQEYVPGYAE RGALMDLTQC       120
     VQEHSDKPAA KLDDYFESIL DVGKFEGKLY ALPWISQPVV LYYNPKLFKE AGVEEPNENW       180
     TWDDFKAAAA KLTNPKKGIY GTAFNGWPPI QMFIWQAGGD VISEDLKHSP IDSPEAIQAE       240
     KFYQEIVYNP KYAAPENIIA EQGFADLAKN GKVAMFFGGA ADDLDYAHAK DPKFAEMKAA       300
     LVPKGPKSRT TFAWTGLMAI NAKTANPEAA CQALLDLTDG IHHWKVLAPR KSLANKETII       360
     QAVPEKAKSA DVIIKAAQDM RTFRVVPQQS EWDTTFSEKF LDPLFHRKGT PEELAKKVRP       420
     ELEAILQGP                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page