(data stored in ACNUC7421 zone)

EMBL: CP001825.PE184

CP001825.PE184       Location/Qualifiers
FT   CDS             199425..201155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0186"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein TPP
FT                   binding domain protein; thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein
FT                   central region; KEGG: scl:sce3730 acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41108"
FT                   /db_xref="GOA:D1CDV2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDV2"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ACZ41108.1"
FT                   /translation="MAITIDKPKIEETKKKETKKLSGARIMCEALVNEGVEIIWGYPGG
FT                   AIMPFYDVLPEYPSIHHVLVRHEQGAAHAADGYARVTGKVGVCVATSGPGATNLVTGLA
FT                   TAYMDSVPIVAITGQVARPFIGHDSFQETDIVGITLPITKHNFLVTSADSLGEVIHEAF
FT                   RIAREGRPGPVLIDVPKDVQFEEGEYTPPEKTWEERNSDNGSAYTDEYIRAARIIDSAQ
FT                   RPLIMAGHGIIISKAYDELRAFAEKTGIPVITTLLGLSAFPENHPLALGMPGMHGPAHV
FT                   NLAIDEADLIVGVGLRFDDRVTGNLKEFAPNARFIHIDIDPAEIGKNIKPEVGIVADAK
FT                   EALAKLTELVSKKEHSGWLEEIKRREKPERSVMKTTKISPYDVLKAIKKATNGEARIVT
FT                   DVGQHQMWAARFYGWEKPNSHISSGGLGTMGYALPAAMGVKAGCPEDPVWVVAGDGGIQ
FT                   MNIQELGTIVQENLDIKVAIINNGYLGMVRQWQEFFHNRNYSETRISSPDYSLIATAYG
FT                   AKGRRVTRKEDVEAAVEWAMSQPGCVILDFEIEQEANVYPMVPSGGSVKTMILDPEANE
FT                   "
     MAITIDKPKI EETKKKETKK LSGARIMCEA LVNEGVEIIW GYPGGAIMPF YDVLPEYPSI        60
     HHVLVRHEQG AAHAADGYAR VTGKVGVCVA TSGPGATNLV TGLATAYMDS VPIVAITGQV       120
     ARPFIGHDSF QETDIVGITL PITKHNFLVT SADSLGEVIH EAFRIAREGR PGPVLIDVPK       180
     DVQFEEGEYT PPEKTWEERN SDNGSAYTDE YIRAARIIDS AQRPLIMAGH GIIISKAYDE       240
     LRAFAEKTGI PVITTLLGLS AFPENHPLAL GMPGMHGPAH VNLAIDEADL IVGVGLRFDD       300
     RVTGNLKEFA PNARFIHIDI DPAEIGKNIK PEVGIVADAK EALAKLTELV SKKEHSGWLE       360
     EIKRREKPER SVMKTTKISP YDVLKAIKKA TNGEARIVTD VGQHQMWAAR FYGWEKPNSH       420
     ISSGGLGTMG YALPAAMGVK AGCPEDPVWV VAGDGGIQMN IQELGTIVQE NLDIKVAIIN       480
     NGYLGMVRQW QEFFHNRNYS ETRISSPDYS LIATAYGAKG RRVTRKEDVE AAVEWAMSQP       540
     GCVILDFEIE QEANVYPMVP SGGSVKTMIL DPEANE                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page