(data stored in ACNUC7421 zone)

EMBL: CP001825.PE191

CP001825.PE191       Location/Qualifiers
FT   CDS             206278..207876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0193"
FT                   /product="2-isopropylmalate synthase/homocitrate synthase
FT                   family protein"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase/homocitrate
FT                   synthase family protein; PFAM: LeuA allosteric
FT                   (dimerisation) domain; pyruvate carboxyltransferase; KEGG:
FT                   afw:Anae109_1753 putative alpha-
FT                   isopropylmalate/homocitrate synthase family transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41115"
FT                   /db_xref="GOA:D1CDV9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDV9"
FT                   /inference="protein motif:TFAM:TIGR00977"
FT                   /protein_id="ACZ41115.1"
FT                   /translation="MRQIKIYDTTLRDGSQMEGISFSVEDKLKLTRRLDELGVHYIEGG
FT                   WPGSNPKDAEYFERMKNIPLKNAKLAAFGSTRRAYASVEEDLNLRMLIEAGTPVITLVG
FT                   KSWDMQVHVVLGCSLEENLAMIKDSIAFCKSYGKEVFFDAEHFFDGYKNNPDYAMRCIH
FT                   AAIEAGADAVVLCDTNGGRMPEEIAQAVEKVVEETRAIAATRPFDVGIHTHNDSELAVA
FT                   NTLIAVQKGATQVQGTINGYGERIGNANLCSIIANLELKYGYHTIGREKVKELTSVSRY
FT                   FAEVANMAHDERLPYVGAKAFTHKAGLHVNAVAKSAETYEHLPPELVGNTRRVTISELG
FT                   GRSNVLMKMAQFGLEAHTSSEQVRQVLEEVKRLEKEGFQFEDAEASFELLVLRAQPDYE
FT                   PPFRLLDFMVVSESRNGGEFLSEATVKIKVGNEVMHTAADGDGPVNALDRAMRKALAPF
FT                   YPELDPVHLTDYKVRVLDNESGTAATVRVWIQSTDGKSTWNTVGSSTNIIEASWLALAD
FT                   SLEYPLRSISKRRLR"
     MRQIKIYDTT LRDGSQMEGI SFSVEDKLKL TRRLDELGVH YIEGGWPGSN PKDAEYFERM        60
     KNIPLKNAKL AAFGSTRRAY ASVEEDLNLR MLIEAGTPVI TLVGKSWDMQ VHVVLGCSLE       120
     ENLAMIKDSI AFCKSYGKEV FFDAEHFFDG YKNNPDYAMR CIHAAIEAGA DAVVLCDTNG       180
     GRMPEEIAQA VEKVVEETRA IAATRPFDVG IHTHNDSELA VANTLIAVQK GATQVQGTIN       240
     GYGERIGNAN LCSIIANLEL KYGYHTIGRE KVKELTSVSR YFAEVANMAH DERLPYVGAK       300
     AFTHKAGLHV NAVAKSAETY EHLPPELVGN TRRVTISELG GRSNVLMKMA QFGLEAHTSS       360
     EQVRQVLEEV KRLEKEGFQF EDAEASFELL VLRAQPDYEP PFRLLDFMVV SESRNGGEFL       420
     SEATVKIKVG NEVMHTAADG DGPVNALDRA MRKALAPFYP ELDPVHLTDY KVRVLDNESG       480
     TAATVRVWIQ STDGKSTWNT VGSSTNIIEA SWLALADSLE YPLRSISKRR LR               532
//

If you have problems or comments...

PBIL Back to PBIL home page