(data stored in ACNUC7421 zone)

EMBL: CP001825.PE192

CP001825.PE192       Location/Qualifiers
FT   CDS             207908..209317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0194"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: bha:BH3056 isopropylmalate isomerase large
FT                   subunit; TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41116"
FT                   /db_xref="GOA:D1CDW0"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW0"
FT                   /inference="protein motif:TFAM:TIGR00170"
FT                   /protein_id="ACZ41116.1"
FT                   /translation="MAPRTLAEKVWEDHVVRRSPGEPDLLYIDLHLVHEVTSPQAFEGL
FT                   RLAGRKVRRPDLTLATMDHNVPTTGLQFGITDPISRAQVEALKKNCADFGIRLFGMGDP
FT                   RQGIVHVIGPEQGLTQPGMTIVCGDSHTSTHGAFGALAFGIGTSEVEHVLATQCLWQRK
FT                   PKMMAIEVNGELPIGVTAKDIILGIIEKIGVDGGNGHIIEYRGDTIRSLSMEQRMTICN
FT                   MSIEAGARAGMIAPDDTTFKYIEGRPHAPKGKAWEKALEYWQSLPTDEGAQFDKVVKLD
FT                   ASQLEPYVTWGTNPGQSVKITGRVPDPSEAKTPAEREAMERALKYMGLEPGTPMTEIKI
FT                   DTVFIGSCTNARIEDLRAAAKILNGRKVAKGVRAMVVPGSMQVKAQAEREGLDKIFKEA
FT                   GFEWRDSGCSMCLGMNPDILEPGKRSASTSNRNFEGRQGPGGRTHLMSPIMAAAAAVAG
FT                   HLVDVREWEVK"
     MAPRTLAEKV WEDHVVRRSP GEPDLLYIDL HLVHEVTSPQ AFEGLRLAGR KVRRPDLTLA        60
     TMDHNVPTTG LQFGITDPIS RAQVEALKKN CADFGIRLFG MGDPRQGIVH VIGPEQGLTQ       120
     PGMTIVCGDS HTSTHGAFGA LAFGIGTSEV EHVLATQCLW QRKPKMMAIE VNGELPIGVT       180
     AKDIILGIIE KIGVDGGNGH IIEYRGDTIR SLSMEQRMTI CNMSIEAGAR AGMIAPDDTT       240
     FKYIEGRPHA PKGKAWEKAL EYWQSLPTDE GAQFDKVVKL DASQLEPYVT WGTNPGQSVK       300
     ITGRVPDPSE AKTPAEREAM ERALKYMGLE PGTPMTEIKI DTVFIGSCTN ARIEDLRAAA       360
     KILNGRKVAK GVRAMVVPGS MQVKAQAERE GLDKIFKEAG FEWRDSGCSM CLGMNPDILE       420
     PGKRSASTSN RNFEGRQGPG GRTHLMSPIM AAAAAVAGHL VDVREWEVK                   469
//

If you have problems or comments...

PBIL Back to PBIL home page