(data stored in ACNUC7421 zone)

EMBL: CP001825.PE195

CP001825.PE195       Location/Qualifiers
FT   CDS             211854..212372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41119"
FT                   /db_xref="GOA:D1CDW3"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41119.1"
FT                   /translation="MSSPPDGIELSHWEERRSIHSRANPTPLIILSLIIIVSLSGILGP
FT                   MRHRATSQNNTSVLEIEGPRFIRTGEIFEMRIHITPRTELKNTVLSVSADLWKDMTINT
FT                   MSPAPQEESSENGNFRFLFGNLSSNKEFLVKVDLQINPSLRGQNHGTIRLLSNGAEINR
FT                   VDYSIMVWP"
     MSSPPDGIEL SHWEERRSIH SRANPTPLII LSLIIIVSLS GILGPMRHRA TSQNNTSVLE        60
     IEGPRFIRTG EIFEMRIHIT PRTELKNTVL SVSADLWKDM TINTMSPAPQ EESSENGNFR       120
     FLFGNLSSNK EFLVKVDLQI NPSLRGQNHG TIRLLSNGAE INRVDYSIMV WP               172
//

If you have problems or comments...

PBIL Back to PBIL home page