(data stored in ACNUC7421 zone)

EMBL: CP001825.PE196

CP001825.PE196       Location/Qualifiers
FT   CDS             212374..212868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0198"
FT                   /product="protein of unknown function DUF421"
FT                   /note="PFAM: protein of unknown function DUF421; KEGG:
FT                   psb:Psyr_0769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41120"
FT                   /db_xref="GOA:D1CDW4"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW4"
FT                   /inference="protein motif:PFAM:PF04239"
FT                   /protein_id="ACZ41120.1"
FT                   /translation="MDIVIRATVIFWGLYILIRLLGKRELAQMTPFELIVLVVMGDLIQ
FT                   QGITHNDFSLTGALIAITTFGFWAASISWATYLSRRFEQFFDGKPIVIVRDGRYIEPNM
FT                   RNARVTRSEVESEMRLAGIANISNVAWAIIEPKGRISFIQSQGDQQSQQSQSEEDMAGT
FT                   M"
     MDIVIRATVI FWGLYILIRL LGKRELAQMT PFELIVLVVM GDLIQQGITH NDFSLTGALI        60
     AITTFGFWAA SISWATYLSR RFEQFFDGKP IVIVRDGRYI EPNMRNARVT RSEVESEMRL       120
     AGIANISNVA WAIIEPKGRI SFIQSQGDQQ SQQSQSEEDM AGTM                        164
//

If you have problems or comments...

PBIL Back to PBIL home page