(data stored in ACNUC7421 zone)

EMBL: CP001825.PE197

CP001825.PE197       Location/Qualifiers
FT   CDS             212889..213224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41121"
FT                   /db_xref="GOA:D1CDW5"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41121.1"
FT                   /translation="MNSNPKVTRWPGDTPPTDEQIQQIMRRENLPFYTWSNSPGDVYAP
FT                   HSHSYHKVLYVAKGSITFGFPETQTKIEMHPGDRLDLPPGIVHDAIVGSEGVVCIEGHR
FT                   YDTGKES"
     MNSNPKVTRW PGDTPPTDEQ IQQIMRRENL PFYTWSNSPG DVYAPHSHSY HKVLYVAKGS        60
     ITFGFPETQT KIEMHPGDRL DLPPGIVHDA IVGSEGVVCI EGHRYDTGKE S                111
//

If you have problems or comments...

PBIL Back to PBIL home page