(data stored in ACNUC7421 zone)

EMBL: CP001825.PE2

CP001825.PE2         Location/Qualifiers
FT   CDS             1468..2256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0002"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="TIGRFAM: biotin/acetyl-CoA-carboxylase ligase; PFAM:
FT                   biotin/lipoate A/B protein ligase; biotin protein ligase
FT                   domain protein; KEGG: gme:Gmet_1987
FT                   biotin--acetyl-CoA-carboxylase ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40926"
FT                   /db_xref="GOA:D1CDC0"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC0"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ACZ40926.1"
FT                   /translation="MDQIDLNKLQQILSHTKILREIAFFEEIDSTNSYLKRIINNVDEG
FT                   IVVIADYQSQGRGRRGRTWVSPRGSSISCSILLSPPLTPNRSYILTAACALSIRDSITP
FT                   LVDKPVSIKWPNDVLIGDLKVCGILAESQINSNQTTITTILGFGINVYEYPKSVNATCI
FT                   ADHATTQISRTDLLASILVSLDSRLQVIYSGNWLQVYEEWKDSISTIGQEVTVITDSSN
FT                   IQGIAIGVSKEGGLIIRTPDNELVTVQAGEASIRKPNPKS"
     MDQIDLNKLQ QILSHTKILR EIAFFEEIDS TNSYLKRIIN NVDEGIVVIA DYQSQGRGRR        60
     GRTWVSPRGS SISCSILLSP PLTPNRSYIL TAACALSIRD SITPLVDKPV SIKWPNDVLI       120
     GDLKVCGILA ESQINSNQTT ITTILGFGIN VYEYPKSVNA TCIADHATTQ ISRTDLLASI       180
     LVSLDSRLQV IYSGNWLQVY EEWKDSISTI GQEVTVITDS SNIQGIAIGV SKEGGLIIRT       240
     PDNELVTVQA GEASIRKPNP KS                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page