(data stored in ACNUC7421 zone)

EMBL: CP001825.PE200

CP001825.PE200       Location/Qualifiers
FT   CDS             214487..215431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0202"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   swi:Swit_0704 luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41124"
FT                   /db_xref="GOA:D1CDW8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW8"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACZ41124.1"
FT                   /translation="MNVIGFGWRFPDFPTDGSSFSDFTQQIRENLDVLVSYNYDSAWVA
FT                   DHFIPWPDWQEEDTPTIECLTTISYYSALYPQIKWGSTVFCQSYRNPAALAKAFAQLCA
FT                   LNPGKYIFGIGAGWKEKEYIEYNFPFPKPSVRITQMAEAIQIAKLLWTQSNATFEGKHY
FT                   RIHEATVNPKPDPLPPIMVGGAGEKLSMRVAAQYADWWNLSGGSIETFRHKLEVLRRHC
FT                   EDVGRSYDSIVKSWSSSCVAVADSSSQAERIARSSPFYSEDSAIFGTPDEVARQVEARI
FT                   SSGVQHFQLRFADFPSTRSMELFGREVIPRFLP"
     MNVIGFGWRF PDFPTDGSSF SDFTQQIREN LDVLVSYNYD SAWVADHFIP WPDWQEEDTP        60
     TIECLTTISY YSALYPQIKW GSTVFCQSYR NPAALAKAFA QLCALNPGKY IFGIGAGWKE       120
     KEYIEYNFPF PKPSVRITQM AEAIQIAKLL WTQSNATFEG KHYRIHEATV NPKPDPLPPI       180
     MVGGAGEKLS MRVAAQYADW WNLSGGSIET FRHKLEVLRR HCEDVGRSYD SIVKSWSSSC       240
     VAVADSSSQA ERIARSSPFY SEDSAIFGTP DEVARQVEAR ISSGVQHFQL RFADFPSTRS       300
     MELFGREVIP RFLP                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page