(data stored in ACNUC7421 zone)

EMBL: CP001825.PE201

CP001825.PE201       Location/Qualifiers
FT   CDS             215582..217738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0203"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: ppd:Ppro_0502 response regulator receiver
FT                   modulated diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s); TIGRFAM: diguanylate cyclase; PAS sensor
FT                   protein; PFAM: EAL domain protein; PAS fold-3 domain
FT                   protein; GGDEF domain containing protein; PAS fold domain
FT                   protein; SMART: EAL domain protein; GGDEF domain containing
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41125"
FT                   /db_xref="GOA:D1CDW9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDW9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACZ41125.1"
FT                   /translation="MLQNEVLIIILLAVLGTATILGISASKRTRTSDKESSKLVSATAL
FT                   THLEACLDAANIPMLIIDQNLSISYASKSLQNLINFVPKALIGASLLELIHREDQETAK
FT                   ELILQQNQAHEVSQADVKLRRAGDGWIRVRAYSGRLPSNLILMLIQDVSLTESLRVQLE
FT                   IEHAKIEIAERVANLGLWERDTSTGQEVWSDQTFKIYGLKPGSLEPSYEYLLRIVHPDD
FT                   RDRVDSAYRDSIKALSAYDVSYRILLPDSSIRVVHSKAQIVKGADSHLLLTGTVQDVTE
FT                   QKVNEESLLRQALHDPLTGLPNRVMLGQQLEKLLASNRSRSIAVLFLDLDNFKAVNDNL
FT                   GHQAGDSLLVAVARRLSANLRPTDFAARFGGDEFTVVVTKVKSIDYVVSIAKRIIESIS
FT                   QPFDIAGERVYTSTSIGIALCSSSEDSASSLLRKADIALYKSKSLGRGTYVIFDQSMEQ
FT                   EASEILELERNLRTAIQNDQFIVHYQPIVDAATGKVEMIEALLRWNSPNGILSPDKFIP
FT                   IAEEVGLINTLGELVLNKACEQTAYLKATTGAKFITSINVSAKQLRQPHFTNNLESMLH
FT                   KYDLQPKDVQLEITENALVEEVECITNALKEIKTLGIRIAIDDFGTGYSSLSYLRKLPI
FT                   DLIKIDQSFVKMLPNDEEHRAIIYTIISLACSLDLEIIAEGVEEKSQREILLSMGCKFI
FT                   QGNLISHPVDLESIKLILGHTSPK"
     MLQNEVLIII LLAVLGTATI LGISASKRTR TSDKESSKLV SATALTHLEA CLDAANIPML        60
     IIDQNLSISY ASKSLQNLIN FVPKALIGAS LLELIHREDQ ETAKELILQQ NQAHEVSQAD       120
     VKLRRAGDGW IRVRAYSGRL PSNLILMLIQ DVSLTESLRV QLEIEHAKIE IAERVANLGL       180
     WERDTSTGQE VWSDQTFKIY GLKPGSLEPS YEYLLRIVHP DDRDRVDSAY RDSIKALSAY       240
     DVSYRILLPD SSIRVVHSKA QIVKGADSHL LLTGTVQDVT EQKVNEESLL RQALHDPLTG       300
     LPNRVMLGQQ LEKLLASNRS RSIAVLFLDL DNFKAVNDNL GHQAGDSLLV AVARRLSANL       360
     RPTDFAARFG GDEFTVVVTK VKSIDYVVSI AKRIIESISQ PFDIAGERVY TSTSIGIALC       420
     SSSEDSASSL LRKADIALYK SKSLGRGTYV IFDQSMEQEA SEILELERNL RTAIQNDQFI       480
     VHYQPIVDAA TGKVEMIEAL LRWNSPNGIL SPDKFIPIAE EVGLINTLGE LVLNKACEQT       540
     AYLKATTGAK FITSINVSAK QLRQPHFTNN LESMLHKYDL QPKDVQLEIT ENALVEEVEC       600
     ITNALKEIKT LGIRIAIDDF GTGYSSLSYL RKLPIDLIKI DQSFVKMLPN DEEHRAIIYT       660
     IISLACSLDL EIIAEGVEEK SQREILLSMG CKFIQGNLIS HPVDLESIKL ILGHTSPK         718
//

If you have problems or comments...

PBIL Back to PBIL home page