(data stored in ACNUC7421 zone)

EMBL: CP001825.PE203

CP001825.PE203       Location/Qualifiers
FT   CDS             218948..220381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0205"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mno:Mnod_3288 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41127"
FT                   /db_xref="GOA:D1CDX1"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDX1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41127.1"
FT                   /translation="MFVDTSRELLRESRFPRISSRFGGDSVTTLLSRTLLPTYFFLLLL
FT                   YSNTPSGHPAAQISEMYRAVLHTPYIPMTTMLFRISHILIMLCLWSSYIAKIRTLSYEN
FT                   SRENWILAIAVTLLAVLTPPVTSRDVFYYSISGEVTSIYKMNPYSTPPSALPASPLYGY
FT                   ADWKFLTFPYGPIWTVICGAVVFISGTGPFASTFTFKILCGSTVLLSAFLIQKISSKIS
FT                   LQPSHKAAMLYAMNPIVLVEAAVNAHLDAFIALLLVLTVLLLISNRKLPGYLALCASAL
FT                   IKPTTVPLLGFFVAARMQEESKLLSKVFQLAKYLIVAAILAFITYYPFWHGAETFGFLS
FT                   SERFSPSGLIPLAVVAIMFFRKFALPWAATTSALASLALVYWSLRKGFELLLGKARGYR
FT                   KEVLIWGTFMFLLPVCFYTAYPWYLLPALALLSITQLYSQRYSRLLFLIAACWFTVWTV
FT                   GTLFFMSLPCCQGSPLQGT"
     MFVDTSRELL RESRFPRISS RFGGDSVTTL LSRTLLPTYF FLLLLYSNTP SGHPAAQISE        60
     MYRAVLHTPY IPMTTMLFRI SHILIMLCLW SSYIAKIRTL SYENSRENWI LAIAVTLLAV       120
     LTPPVTSRDV FYYSISGEVT SIYKMNPYST PPSALPASPL YGYADWKFLT FPYGPIWTVI       180
     CGAVVFISGT GPFASTFTFK ILCGSTVLLS AFLIQKISSK ISLQPSHKAA MLYAMNPIVL       240
     VEAAVNAHLD AFIALLLVLT VLLLISNRKL PGYLALCASA LIKPTTVPLL GFFVAARMQE       300
     ESKLLSKVFQ LAKYLIVAAI LAFITYYPFW HGAETFGFLS SERFSPSGLI PLAVVAIMFF       360
     RKFALPWAAT TSALASLALV YWSLRKGFEL LLGKARGYRK EVLIWGTFMF LLPVCFYTAY       420
     PWYLLPALAL LSITQLYSQR YSRLLFLIAA CWFTVWTVGT LFFMSLPCCQ GSPLQGT          477
//

If you have problems or comments...

PBIL Back to PBIL home page