(data stored in ACNUC7421 zone)

EMBL: CP001825.PE204

CP001825.PE204       Location/Qualifiers
FT   CDS             complement(220361..221206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0206"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH3847 ABC transporter
FT                   (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41128"
FT                   /db_xref="GOA:D1CDX2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDX2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41128.1"
FT                   /translation="MSTKPMQLPRIRYSRIIIYLVMIAFAVFYLLPVYLMLITGMKSFE
FT                   EVSISRMWALPSSLSFDSFAAAWERLDVSFLNSIKLVIPATVISSVLGSMNGYVLSKWK
FT                   FKGADTIFTAILFGMFIPYQSILIPLVLTLQKIGLYGSIPGLILTHVVYGIPITTLIFR
FT                   NYYAGIPGELVEAGKVDGAGFFGIYRHIIFPLSVTGFVVVAIWQFTSIWNEFLFGLIIT
FT                   NSPEQRPVTVALQNIAGSQYTLWNVQMAGALLVAIPTLVVYVLLGRYFLRGLLSGALKG
FT                   "
     MSTKPMQLPR IRYSRIIIYL VMIAFAVFYL LPVYLMLITG MKSFEEVSIS RMWALPSSLS        60
     FDSFAAAWER LDVSFLNSIK LVIPATVISS VLGSMNGYVL SKWKFKGADT IFTAILFGMF       120
     IPYQSILIPL VLTLQKIGLY GSIPGLILTH VVYGIPITTL IFRNYYAGIP GELVEAGKVD       180
     GAGFFGIYRH IIFPLSVTGF VVVAIWQFTS IWNEFLFGLI ITNSPEQRPV TVALQNIAGS       240
     QYTLWNVQMA GALLVAIPTL VVYVLLGRYF LRGLLSGALK G                           281
//

If you have problems or comments...

PBIL Back to PBIL home page