(data stored in ACNUC7421 zone)

EMBL: CP001825.PE206

CP001825.PE206       Location/Qualifiers
FT   CDS             complement(222264..223628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0208"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bha:BH3845 ABC transporter (substrate-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41130"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDX4"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ41130.1"
FT                   /translation="MRSKISILSIFLIFASILFIACGGQGGTPTASTGGTSQSPSPSPA
FT                   ASAQPTQPANQGSSAGENKLEIFSWWTNPGEADGLKALFEIFKKRRPGVEVINATVAGG
FT                   AGTNAKAVLVTRMRGGDPPDSFQVHAGQELIGTWVVAGKMEPITDLFKQEGWDKVMPKT
FT                   LLDQITYKGEIYSVPVNVHRSNMLWYNIEIFKKNNLQPPKTIDDFFKVAEKLKAKGITP
FT                   LSVGGKDKFEVPHLFESVLLATFGPEDYPKLFKDPSMWENDPRLDKAIDTLNKMLDYAN
FT                   EDRASLSWADAAQRVIDGEAAMTIMGDWAEGYFINKGAKPNKDFGWAPAPGTSGSFLWL
FT                   SDSFGLPKGAPHRENAIEWLKVCGSKEGQDAFNPKKGSIPARTDADKSKYDVYLRWSID
FT                   EFKRDKLVPSIVHGAAANEAYMTDYDNALNLFSANRDKEELKGMLLDAASELQSQ"
     MRSKISILSI FLIFASILFI ACGGQGGTPT ASTGGTSQSP SPSPAASAQP TQPANQGSSA        60
     GENKLEIFSW WTNPGEADGL KALFEIFKKR RPGVEVINAT VAGGAGTNAK AVLVTRMRGG       120
     DPPDSFQVHA GQELIGTWVV AGKMEPITDL FKQEGWDKVM PKTLLDQITY KGEIYSVPVN       180
     VHRSNMLWYN IEIFKKNNLQ PPKTIDDFFK VAEKLKAKGI TPLSVGGKDK FEVPHLFESV       240
     LLATFGPEDY PKLFKDPSMW ENDPRLDKAI DTLNKMLDYA NEDRASLSWA DAAQRVIDGE       300
     AAMTIMGDWA EGYFINKGAK PNKDFGWAPA PGTSGSFLWL SDSFGLPKGA PHRENAIEWL       360
     KVCGSKEGQD AFNPKKGSIP ARTDADKSKY DVYLRWSIDE FKRDKLVPSI VHGAAANEAY       420
     MTDYDNALNL FSANRDKEEL KGMLLDAASE LQSQ                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page