(data stored in ACNUC7421 zone)

EMBL: CP001825.PE210

CP001825.PE210       Location/Qualifiers
FT   CDS             complement(228101..229555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0212"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: bsu:BSU02470
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41134"
FT                   /db_xref="GOA:D1CDX8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDX8"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACZ41134.1"
FT                   /translation="MEILAHYIAGEWISSTSEEYKDDVNPSDFGQVLAKIPLGDESTVQ
FT                   RAVEAANNAFKGWKHTPGPGRAEFMHRVANLLAQHRQDVARVVALEVGKPIGEALAEVD
FT                   RGVVILRYYAEEAVHPMGSVIPSQVPGSLQFTVREPVGPLGVITPWNFPVAIPLWKISP
FT                   AIAFGNTVVWKPAETSSMVAVHLMKIFAEAGLPQGVINLVLGSGSKIGKALVASDGIRA
FT                   VTFTGSEGVGMGIAQQAAQRNIKYQLEMGGKNAAIVLPDADLRLAARLIASGAMRYAGQ
FT                   KCTATSRVVVVADVIDSFIDHLTEEVKALPVAPAIDANSAVGPLISEDALSKVSYYADE
FT                   GAKSGEVVLGGKRAQGSLLDRGYFFEPTVIRNVSPDAKVAQEEIFGPVLVVHEAKGLDD
FT                   AINIANNSRYGLSVSMFTRDINAILSYIPNIEAGMVRVNADTTGVDPHAPFGGMKSSSS
FT                   HSREQGPAAVEFFTDTKTVQINPVTG"
     MEILAHYIAG EWISSTSEEY KDDVNPSDFG QVLAKIPLGD ESTVQRAVEA ANNAFKGWKH        60
     TPGPGRAEFM HRVANLLAQH RQDVARVVAL EVGKPIGEAL AEVDRGVVIL RYYAEEAVHP       120
     MGSVIPSQVP GSLQFTVREP VGPLGVITPW NFPVAIPLWK ISPAIAFGNT VVWKPAETSS       180
     MVAVHLMKIF AEAGLPQGVI NLVLGSGSKI GKALVASDGI RAVTFTGSEG VGMGIAQQAA       240
     QRNIKYQLEM GGKNAAIVLP DADLRLAARL IASGAMRYAG QKCTATSRVV VVADVIDSFI       300
     DHLTEEVKAL PVAPAIDANS AVGPLISEDA LSKVSYYADE GAKSGEVVLG GKRAQGSLLD       360
     RGYFFEPTVI RNVSPDAKVA QEEIFGPVLV VHEAKGLDDA INIANNSRYG LSVSMFTRDI       420
     NAILSYIPNI EAGMVRVNAD TTGVDPHAPF GGMKSSSSHS REQGPAAVEF FTDTKTVQIN       480
     PVTG                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page