(data stored in ACNUC7421 zone)

EMBL: CP001825.PE212

CP001825.PE212       Location/Qualifiers
FT   CDS             complement(230294..231664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0214"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: bha:BH3875 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41136"
FT                   /db_xref="GOA:D1CDY0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY0"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /protein_id="ACZ41136.1"
FT                   /translation="MSDEVFSRIDASSHKYLEDLKEFLRIPSISALSDYKAEVARCAQW
FT                   LKEHMITIGLQKAEVIPTSGHPIVYGEWMGSDSGRTILVYGHYDVQPPDPLDLWQTPPF
FT                   EPSVREGRIYARGAVDDKGQVMMHLKAVQSLLEEYGKLPVNLKFIIEGEEEIGSPSLDE
FT                   FLVQNKDRLSSEAVVISDTGWIAPGVPSITYALRGLSYIQVDVYGPKSDLHSGSYGGAV
FT                   MNPAEAIACIIASLKDDKGRIKVDGFYDKVVELTSQEREEFSKLPFDEESFRQALGVDQ
FT                   LYGEEGYSTLERLWARPTLDVNGIWGGFTGEGSKTVIPAEAHAKISCRLVPDQDPEEIS
FT                   DLLETYIRKITPPGVRVEIQRMHGGKPAIVPIDHPINQAAARALEKAFGKKAVFIRAGG
FT                   TIPVVASLKEILGLPSILMGMGLPDENAHAPNEWFLLDNFYGGIKSVAALWLDLGAA"
     MSDEVFSRID ASSHKYLEDL KEFLRIPSIS ALSDYKAEVA RCAQWLKEHM ITIGLQKAEV        60
     IPTSGHPIVY GEWMGSDSGR TILVYGHYDV QPPDPLDLWQ TPPFEPSVRE GRIYARGAVD       120
     DKGQVMMHLK AVQSLLEEYG KLPVNLKFII EGEEEIGSPS LDEFLVQNKD RLSSEAVVIS       180
     DTGWIAPGVP SITYALRGLS YIQVDVYGPK SDLHSGSYGG AVMNPAEAIA CIIASLKDDK       240
     GRIKVDGFYD KVVELTSQER EEFSKLPFDE ESFRQALGVD QLYGEEGYST LERLWARPTL       300
     DVNGIWGGFT GEGSKTVIPA EAHAKISCRL VPDQDPEEIS DLLETYIRKI TPPGVRVEIQ       360
     RMHGGKPAIV PIDHPINQAA ARALEKAFGK KAVFIRAGGT IPVVASLKEI LGLPSILMGM       420
     GLPDENAHAP NEWFLLDNFY GGIKSVAALW LDLGAA                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page