(data stored in ACNUC7421 zone)

EMBL: CP001825.PE214

CP001825.PE214       Location/Qualifiers
FT   CDS             complement(232141..233466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0216"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="PFAM: glycoside hydrolase family 4; KEGG:
FT                   lch:Lcho_3239 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41138"
FT                   /db_xref="GOA:D1CDY2"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY2"
FT                   /inference="protein motif:PFAM:PF02056"
FT                   /protein_id="ACZ41138.1"
FT                   /translation="MPKIAFIGAGSAVFTRNLLGDLLTYPELDGSTISLMDIDANRLKA
FT                   VESLAKKMVEQEGSKMVIEATTDRSQALQNADYVVITIQVGGLKAYELDIEIPRKYGVE
FT                   QCVGDTIGPGGVFRGLRHLAVIEEICNDLEELSPDALILQYTNPMAILCWGISSMSSIR
FT                   FVGLCHSVQGTSEELAHIAGVPYEELSYWVAGINHMSWFLRLEHKGRDLYPLLFEKMSD
FT                   PDTYALDPIRFDLMKHFGYFVTESSGHASEYYPYFRKRQDVLEQTLAKFTHPRHGWFKF
FT                   GQTGGYLKHCFEVADHYYEDIEDQLKADKIEIRRSREYGAQIIHSIETNTPRRINGNVT
FT                   NYDLITNLPYGCCVEVPCLVDNTGINPCYVGDLPPQLAGLIRTNVNLQELAVLGHIHRD
FT                   KTLVKQAIKMDPLTAAVCSLEEIDNMVDELFDAQKEWLPQFD"
     MPKIAFIGAG SAVFTRNLLG DLLTYPELDG STISLMDIDA NRLKAVESLA KKMVEQEGSK        60
     MVIEATTDRS QALQNADYVV ITIQVGGLKA YELDIEIPRK YGVEQCVGDT IGPGGVFRGL       120
     RHLAVIEEIC NDLEELSPDA LILQYTNPMA ILCWGISSMS SIRFVGLCHS VQGTSEELAH       180
     IAGVPYEELS YWVAGINHMS WFLRLEHKGR DLYPLLFEKM SDPDTYALDP IRFDLMKHFG       240
     YFVTESSGHA SEYYPYFRKR QDVLEQTLAK FTHPRHGWFK FGQTGGYLKH CFEVADHYYE       300
     DIEDQLKADK IEIRRSREYG AQIIHSIETN TPRRINGNVT NYDLITNLPY GCCVEVPCLV       360
     DNTGINPCYV GDLPPQLAGL IRTNVNLQEL AVLGHIHRDK TLVKQAIKMD PLTAAVCSLE       420
     EIDNMVDELF DAQKEWLPQF D                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page