(data stored in ACNUC7421 zone)

EMBL: CP001825.PE215

CP001825.PE215       Location/Qualifiers
FT   CDS             233613..234647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0217"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; homoserine
FT                   dehydrogenase NAD-binding; Oxidoreductase domain; KEGG:
FT                   rle:RL0824 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41139"
FT                   /db_xref="GOA:D1CDY3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY3"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACZ41139.1"
FT                   /translation="MPGRTLGFGIIGAGMIAEYHKKAIEANSDLGAKLIAIGHYDPSKF
FT                   SQISTKFGVPCISVQNLLAHPDVDVVTICTPSGQHASQALDAMRAGKHVLVEKPMALNL
FT                   EDADSMIDLARSQGVKLGVVLQRRMDPTFQAVKQAIDAGDLGRLTLGLVKIPYFRPQTY
FT                   YDQAAWRGTWVLDGGGVIMNQGIHLVDLLVWYMGDPQQVSAYADTLSRDIEVEDTLVGI
FT                   IRFSNGAMATITATTTTSPGFPHTVEIYGTHGGIQLEGEGIRRWELAEPSKARVKAPGV
FT                   AENASAGAAADPRGISTENHTRLFRDFILAIQENRDPSIDGSEGRRSLALTLELYKSAG
FT                   LLQK"
     MPGRTLGFGI IGAGMIAEYH KKAIEANSDL GAKLIAIGHY DPSKFSQIST KFGVPCISVQ        60
     NLLAHPDVDV VTICTPSGQH ASQALDAMRA GKHVLVEKPM ALNLEDADSM IDLARSQGVK       120
     LGVVLQRRMD PTFQAVKQAI DAGDLGRLTL GLVKIPYFRP QTYYDQAAWR GTWVLDGGGV       180
     IMNQGIHLVD LLVWYMGDPQ QVSAYADTLS RDIEVEDTLV GIIRFSNGAM ATITATTTTS       240
     PGFPHTVEIY GTHGGIQLEG EGIRRWELAE PSKARVKAPG VAENASAGAA ADPRGISTEN       300
     HTRLFRDFIL AIQENRDPSI DGSEGRRSLA LTLELYKSAG LLQK                        344
//

If you have problems or comments...

PBIL Back to PBIL home page