(data stored in ACNUC7421 zone)

EMBL: CP001825.PE216

CP001825.PE216       Location/Qualifiers
FT   CDS             234790..235332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0218"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: gsu:GSU2525
FT                   nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41140"
FT                   /db_xref="GOA:D1CDY4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY4"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACZ41140.1"
FT                   /translation="MTTASDKISFLKSLRAIREFTPQPIPDDVIDDVLEVARWSGSAVN
FT                   RQPWEFIVIRDKDTLKKLATVEGHAGHLAGAATGIVLVMAGESFEHETYDEGRLAERIM
FT                   LAAWAHGVGGCIGWFGENGRSEVKAALGIPDNKFVRTAISLGYPDYEVRKNRPRREQPR
FT                   KPLSEIVHWERYGQHNR"
     MTTASDKISF LKSLRAIREF TPQPIPDDVI DDVLEVARWS GSAVNRQPWE FIVIRDKDTL        60
     KKLATVEGHA GHLAGAATGI VLVMAGESFE HETYDEGRLA ERIMLAAWAH GVGGCIGWFG       120
     ENGRSEVKAA LGIPDNKFVR TAISLGYPDY EVRKNRPRRE QPRKPLSEIV HWERYGQHNR       180
//

If you have problems or comments...

PBIL Back to PBIL home page