(data stored in ACNUC7421 zone)

EMBL: CP001825.PE219

CP001825.PE219       Location/Qualifiers
FT   CDS             238823..240118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0221"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   bat:BAS4308 stage V sporulation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41143"
FT                   /db_xref="GOA:D1CDY7"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY7"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ACZ41143.1"
FT                   /translation="MSIPIVEKIRGQKLISSRQGVGAGSIYLALSLGITGVFTYGFQIL
FT                   SAYFLRLEDYGVIATLWSATFLVAQILWIGITQTLAKYIPEREAKAESWLPVLRSVRHL
FT                   QYIVLAIFILVTLVTFPLLTERIFAHKPIITAVFIMAVAGYSFSYFKRGVLSGYKKFSH
FT                   VGLMFITESCSRLLLSVGLLLIGLGLTAPGIGIAIAPFLSVLLVRTKIDVPQAGSSEHF
FT                   SIGKAFRFATPVLICMACAQLLANGGPIMISALGGPNAQAQAGLLLAGLVLTRIPQYVL
FT                   SPVMSNLLPHLSEMIAKGDHRKFNNFVKIAALALGAMGGILVAGFWLMGTFAMSLMYKP
FT                   EYRLSRGLLTVLALGAACYLFNEFMNQVLFAKSRTRLASLSWILGIVVTLAATLMISAD
FT                   PLHRVAYALAIGTLSTSIFLILSHLVTRPSQM"
     MSIPIVEKIR GQKLISSRQG VGAGSIYLAL SLGITGVFTY GFQILSAYFL RLEDYGVIAT        60
     LWSATFLVAQ ILWIGITQTL AKYIPEREAK AESWLPVLRS VRHLQYIVLA IFILVTLVTF       120
     PLLTERIFAH KPIITAVFIM AVAGYSFSYF KRGVLSGYKK FSHVGLMFIT ESCSRLLLSV       180
     GLLLIGLGLT APGIGIAIAP FLSVLLVRTK IDVPQAGSSE HFSIGKAFRF ATPVLICMAC       240
     AQLLANGGPI MISALGGPNA QAQAGLLLAG LVLTRIPQYV LSPVMSNLLP HLSEMIAKGD       300
     HRKFNNFVKI AALALGAMGG ILVAGFWLMG TFAMSLMYKP EYRLSRGLLT VLALGAACYL       360
     FNEFMNQVLF AKSRTRLASL SWILGIVVTL AATLMISADP LHRVAYALAI GTLSTSIFLI       420
     LSHLVTRPSQ M                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page