(data stored in ACNUC7421 zone)

EMBL: CP001825.PE22

CP001825.PE22        Location/Qualifiers
FT   CDS             complement(23367..24563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0023"
FT                   /product="geranylgeranyl reductase"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM:
FT                   monooxygenase FAD-binding; KEGG: psb:Psyr_0428
FT                   monooxygenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40946"
FT                   /db_xref="GOA:D1CDE0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE0"
FT                   /inference="protein motif:TFAM:TIGR02032"
FT                   /protein_id="ACZ40946.1"
FT                   /translation="MIEEREVVIVGGGPAGSSVANVLASLGHDVLLLDKSRFPRPKPCS
FT                   EYMSPGILPLLSNLGIDADLSGMHMLKGMRIHTPAGSQITIEYVDEHNGRYYAPTMERH
FT                   VFDKMLLDHAAHKGVEVRYQAKVMSVVSQDNYSILRVQLPDRAQMDIRTKLVIGADGLR
FT                   SVVARNLSRRYPLIWPKRMGLVTHINLPGIDADYGDMYVHPWGYCGVAATGKSSASVGI
FT                   VLDLRRMALTRGREAIFEDSLKLFPKAHKQICGAASFDRIMGISPIGHGVKEVHGRNWA
FT                   LVGDAAGFFDPFTGEGIYKAVRGGILLGEVVSPYLKVGRIKEGLERYATERARVFRRKS
FT                   LLVSLIQIFISYPYMLEYVANKLQDREALRLSLSRGIGDLQDPLYNLNLRFLFGLLRP"
     MIEEREVVIV GGGPAGSSVA NVLASLGHDV LLLDKSRFPR PKPCSEYMSP GILPLLSNLG        60
     IDADLSGMHM LKGMRIHTPA GSQITIEYVD EHNGRYYAPT MERHVFDKML LDHAAHKGVE       120
     VRYQAKVMSV VSQDNYSILR VQLPDRAQMD IRTKLVIGAD GLRSVVARNL SRRYPLIWPK       180
     RMGLVTHINL PGIDADYGDM YVHPWGYCGV AATGKSSASV GIVLDLRRMA LTRGREAIFE       240
     DSLKLFPKAH KQICGAASFD RIMGISPIGH GVKEVHGRNW ALVGDAAGFF DPFTGEGIYK       300
     AVRGGILLGE VVSPYLKVGR IKEGLERYAT ERARVFRRKS LLVSLIQIFI SYPYMLEYVA       360
     NKLQDREALR LSLSRGIGDL QDPLYNLNLR FLFGLLRP                               398
//

If you have problems or comments...

PBIL Back to PBIL home page