(data stored in ACNUC7421 zone)

EMBL: CP001825.PE221

CP001825.PE221       Location/Qualifiers
FT   CDS             complement(241364..242695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0223"
FT                   /product="UDP-N-acetylglucosamine1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1- carboxyvinyltransferase); KEGG:
FT                   mgm:Mmc1_1221 UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41145"
FT                   /db_xref="GOA:D1CDY9"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDY9"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ACZ41145.1"
FT                   /translation="MHTLLIEGGVPLRGEVRIAGAKNAALKMMAAALLTEEEVHLSNVP
FT                   HISDVYVMSALLQTLGVEVNWNGPNTLRIRAKDIRPVRFGIDVAAKIRASFVVMAPLLA
FT                   RCGEASVPNPGGDRIGHRPVDRLVEGLRHFGVCIDYDGAYYNATCDRLRGCEYRFNKNS
FT                   HMGTEHQIMAAVLAEGRSVIYNAAQEPEVDDLIDMLNSMGARIKRVEPRTIVIDGVRKL
FT                   GGTHHTVMPDRIEAGTFAIMAAATDGDLYLSGANPDHMQALLDKMKEAGCRIEADPEGI
FT                   RVRRGESLRAVNVITRPHPGFMTDWQAPFVVLLTQASGVSLVHETIFPNRLGYTEQLNL
FT                   MGAHIELFNPPVPDCGYEWNEKDDSPDYFHAARIYGPTPLRAANLTIPDLRAGATLIIA
FT                   ALCAEGVSKVSGVQWVERGYEHFVERLRSLGARIEESLPAEATA"
     MHTLLIEGGV PLRGEVRIAG AKNAALKMMA AALLTEEEVH LSNVPHISDV YVMSALLQTL        60
     GVEVNWNGPN TLRIRAKDIR PVRFGIDVAA KIRASFVVMA PLLARCGEAS VPNPGGDRIG       120
     HRPVDRLVEG LRHFGVCIDY DGAYYNATCD RLRGCEYRFN KNSHMGTEHQ IMAAVLAEGR       180
     SVIYNAAQEP EVDDLIDMLN SMGARIKRVE PRTIVIDGVR KLGGTHHTVM PDRIEAGTFA       240
     IMAAATDGDL YLSGANPDHM QALLDKMKEA GCRIEADPEG IRVRRGESLR AVNVITRPHP       300
     GFMTDWQAPF VVLLTQASGV SLVHETIFPN RLGYTEQLNL MGAHIELFNP PVPDCGYEWN       360
     EKDDSPDYFH AARIYGPTPL RAANLTIPDL RAGATLIIAA LCAEGVSKVS GVQWVERGYE       420
     HFVERLRSLG ARIEESLPAE ATA                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page