(data stored in ACNUC7421 zone)

EMBL: CP001825.PE222

CP001825.PE222       Location/Qualifiers
FT   CDS             complement(242889..243116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41146"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41146.1"
FT                   /translation="MKLVAVGTFSDAILAEMYAELLRRQGVPVMVQPVGAHLGGWAVGV
FT                   ASMHRLLVPEDYFDRANRILLEYLAGDEES"
     MKLVAVGTFS DAILAEMYAE LLRRQGVPVM VQPVGAHLGG WAVGVASMHR LLVPEDYFDR        60
     ANRILLEYLA GDEES                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page