(data stored in ACNUC7421 zone)

EMBL: CP001825.PE225

CP001825.PE225       Location/Qualifiers
FT   CDS             244639..245700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0227"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: gur:Gura_4035 threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41149"
FT                   /db_xref="GOA:D1CDZ3"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ3"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ACZ41149.1"
FT                   /translation="MYTASGSGKEVLCGDEDRMLTLNDILEARDRISPYIERTPLKESH
FT                   TLSNRLGAKVYLKLEMFQTTGAFKIRGAFNKMLSLSPEEKNRGVVAVSGGNHAQAVAYA
FT                   ASKLGIKATVFMARNTPENYIEATEHYGAQVVLTSDIAEAFKLAAERQAYGEVMIHPYA
FT                   DNQVMAGQGTIGLEILEDLPQVTDVIISIGGGGLISGVATAIKSQKPHVRIWGVETAGA
FT                   DSMSQALRAGHPIELPAITSIAKTLGAPSVSENTLAITRKLVESVTVVSDKEAFQALEF
FT                   LLERAKVLTEPAASCTLAAAERLRSAFTPQSTLVLLLCGGNVSLADLCHYRQMFSVEDK
FT                   KHRSQLEHHEISL"
     MYTASGSGKE VLCGDEDRML TLNDILEARD RISPYIERTP LKESHTLSNR LGAKVYLKLE        60
     MFQTTGAFKI RGAFNKMLSL SPEEKNRGVV AVSGGNHAQA VAYAASKLGI KATVFMARNT       120
     PENYIEATEH YGAQVVLTSD IAEAFKLAAE RQAYGEVMIH PYADNQVMAG QGTIGLEILE       180
     DLPQVTDVII SIGGGGLISG VATAIKSQKP HVRIWGVETA GADSMSQALR AGHPIELPAI       240
     TSIAKTLGAP SVSENTLAIT RKLVESVTVV SDKEAFQALE FLLERAKVLT EPAASCTLAA       300
     AERLRSAFTP QSTLVLLLCG GNVSLADLCH YRQMFSVEDK KHRSQLEHHE ISL              353
//

If you have problems or comments...

PBIL Back to PBIL home page