(data stored in ACNUC7421 zone)

EMBL: CP001825.PE227

CP001825.PE227       Location/Qualifiers
FT   CDS             246864..248039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0229"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; SMART:
FT                   extracellular solute-binding protein family 3; KEGG:
FT                   rpd:RPD_2108 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41151"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ5"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ACZ41151.1"
FT                   /translation="MSDCCNRNIMERDICPCDGIDLLDDSQTAPEIQTHPITRRQVLKY
FT                   MGGFLLTGFIAACGQAGGPQAQKSPVPTSIVSSQPTAPSREGLTKLDLAFCSQVLCILP
FT                   FEVARQQGYFADEGYDVNLIYMKGGALAINALISKSVDFVGTPMDLIVRSVDQGQPVIM
FT                   VASTSRLPFFALVVSPGKSSEITKISDLQGKRVGVNNLGTTDDLLLKALLAKNNLDPNS
FT                   TDSVALGPNLYDALLRGEVDAGMVQEPALTLLSQKGARVLVNFMDRQQTNEVLGGDYQF
FT                   MGLNTRPDVLDSKPDVVEKLARALVKANQWILNHTGSEIVKAAPQELAPGDDIQIFAKA
FT                   LDKYKESLYPSDGVIEEHAVRRVVETQKISGLLKNENIDISTLYTNKYVEG"
     MSDCCNRNIM ERDICPCDGI DLLDDSQTAP EIQTHPITRR QVLKYMGGFL LTGFIAACGQ        60
     AGGPQAQKSP VPTSIVSSQP TAPSREGLTK LDLAFCSQVL CILPFEVARQ QGYFADEGYD       120
     VNLIYMKGGA LAINALISKS VDFVGTPMDL IVRSVDQGQP VIMVASTSRL PFFALVVSPG       180
     KSSEITKISD LQGKRVGVNN LGTTDDLLLK ALLAKNNLDP NSTDSVALGP NLYDALLRGE       240
     VDAGMVQEPA LTLLSQKGAR VLVNFMDRQQ TNEVLGGDYQ FMGLNTRPDV LDSKPDVVEK       300
     LARALVKANQ WILNHTGSEI VKAAPQELAP GDDIQIFAKA LDKYKESLYP SDGVIEEHAV       360
     RRVVETQKIS GLLKNENIDI STLYTNKYVE G                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page