(data stored in ACNUC7421 zone)

EMBL: CP001825.PE230

CP001825.PE230       Location/Qualifiers
FT   CDS             250059..252536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0232"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: glo:Glov_2744 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41154"
FT                   /db_xref="GOA:D1CDZ8"
FT                   /db_xref="InterPro:IPR018580"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41154.1"
FT                   /translation="MLSYKFMKALRYVRAHQRTLPSFFSLELRKLDVLGALGAVSLTLL
FT                   AVAHMVIKGTAVGLDSAVFFYPMYHYLGSSLRSGEIPVWNPFLFSGFPFAASPQSGWMY
FT                   LPAMAFFTLLSLSEAAKTYILFHWVVSAIAVYVLARDLGLSVSGSVLASVAYSINGFSY
FT                   ERTVCCFAYSGVYTWVPVALLGCERAIKTRELLNKWIWIAISSFSLAQIFSAWPGQGFY
FT                   YGFLLIASYLTFRILVFPEHRSGIIARITQLLSTGIIMGILAFGLGAADILPKLSFLSQ
FT                   SNLASGYTLQQAGVHSGWTILESLSLLGPTTWYLGVTVFSLALAAPFLVRTRYMTPFWI
FT                   VWMFACLVLASRSQTLLHLILYEFLPMFRSLHPHDPERIMMTFYIAPSLLAGSTITYLL
FT                   QLDRKRIKRKVYWLILVPPILLAFITAYAASQITIYVSIILLVFSIGLGIYIVNPSAQN
FT                   KILLTLLVLACVFADLYIVNNHVQAQRLQTRMVYALRKVNLESYYSSTKAVKFLRSQGP
FT                   NYTFRFFGYDPRLRWFPGKADPSIPPPGILYRYLWMDYRTKILLVNNRALVTGIQDIQG
FT                   YNPLQLSSYDSFFGVINGQSQEYRSTYVLQRGLSSPLLDLLNARYVITLRSFGPNFPEY
FT                   ESLEKTSRLVYEDSTIRIWERQTALPRAWIVHSWQNAPYEEVLHILANNALDFRKIALV
FT                   EGLESHIQDINPSDDAVTIDHYSQSRITLTTKSHLPGMLILSEVYYPDWRAYLDGKPVN
FT                   IYRAYGLLRAVTIPAGEHKIEFRYESKSLEYGLIISISFYLLVASLLLSKLLTYAKSRT
FT                   MDNIRGRSIDIRN"
     MLSYKFMKAL RYVRAHQRTL PSFFSLELRK LDVLGALGAV SLTLLAVAHM VIKGTAVGLD        60
     SAVFFYPMYH YLGSSLRSGE IPVWNPFLFS GFPFAASPQS GWMYLPAMAF FTLLSLSEAA       120
     KTYILFHWVV SAIAVYVLAR DLGLSVSGSV LASVAYSING FSYERTVCCF AYSGVYTWVP       180
     VALLGCERAI KTRELLNKWI WIAISSFSLA QIFSAWPGQG FYYGFLLIAS YLTFRILVFP       240
     EHRSGIIARI TQLLSTGIIM GILAFGLGAA DILPKLSFLS QSNLASGYTL QQAGVHSGWT       300
     ILESLSLLGP TTWYLGVTVF SLALAAPFLV RTRYMTPFWI VWMFACLVLA SRSQTLLHLI       360
     LYEFLPMFRS LHPHDPERIM MTFYIAPSLL AGSTITYLLQ LDRKRIKRKV YWLILVPPIL       420
     LAFITAYAAS QITIYVSIIL LVFSIGLGIY IVNPSAQNKI LLTLLVLACV FADLYIVNNH       480
     VQAQRLQTRM VYALRKVNLE SYYSSTKAVK FLRSQGPNYT FRFFGYDPRL RWFPGKADPS       540
     IPPPGILYRY LWMDYRTKIL LVNNRALVTG IQDIQGYNPL QLSSYDSFFG VINGQSQEYR       600
     STYVLQRGLS SPLLDLLNAR YVITLRSFGP NFPEYESLEK TSRLVYEDST IRIWERQTAL       660
     PRAWIVHSWQ NAPYEEVLHI LANNALDFRK IALVEGLESH IQDINPSDDA VTIDHYSQSR       720
     ITLTTKSHLP GMLILSEVYY PDWRAYLDGK PVNIYRAYGL LRAVTIPAGE HKIEFRYESK       780
     SLEYGLIISI SFYLLVASLL LSKLLTYAKS RTMDNIRGRS IDIRN                       825
//

If you have problems or comments...

PBIL Back to PBIL home page