(data stored in ACNUC7421 zone)

EMBL: CP001825.PE232

CP001825.PE232       Location/Qualifiers
FT   CDS             253460..254419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0234"
FT                   /product="ribonuclease BN"
FT                   /note="TIGRFAM: ribonuclease BN; PFAM: ribonuclease BN;
FT                   KEGG: pap:PSPA7_2488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41156"
FT                   /db_xref="GOA:D1CE00"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE00"
FT                   /inference="protein motif:TFAM:TIGR00765"
FT                   /protein_id="ACZ41156.1"
FT                   /translation="MSFLVPYLNKLEQLGNKIRVPLARHIGIADLLKQVWKEASEDHLG
FT                   DFAASLTYHGIFAIFPFLTFLISMLGIFDKVLGVFDTSQLIKDFLSRPQVRQAIPVEVI
FT                   DFVQQQIDRLIGNIRPGTFTTGAIVSVLLALWGVSGAFRSIMESLNVVYEIKDSRPIWK
FT                   KYLISIMLSVIAVLLLLSAGILAVFGPKIADWLARTTGLGTLFAWSWKIAQWPLLILIA
FT                   LLAFALIYHYGPDIKQPLRLVTPGSILALLGWLVFTLIFSLYVNNFGNYNKTYGTLAGA
FT                   ILLMLYMYYSSYILLMGGEVNHVVETYSKTSEEVKQSV"
     MSFLVPYLNK LEQLGNKIRV PLARHIGIAD LLKQVWKEAS EDHLGDFAAS LTYHGIFAIF        60
     PFLTFLISML GIFDKVLGVF DTSQLIKDFL SRPQVRQAIP VEVIDFVQQQ IDRLIGNIRP       120
     GTFTTGAIVS VLLALWGVSG AFRSIMESLN VVYEIKDSRP IWKKYLISIM LSVIAVLLLL       180
     SAGILAVFGP KIADWLARTT GLGTLFAWSW KIAQWPLLIL IALLAFALIY HYGPDIKQPL       240
     RLVTPGSILA LLGWLVFTLI FSLYVNNFGN YNKTYGTLAG AILLMLYMYY SSYILLMGGE       300
     VNHVVETYSK TSEEVKQSV                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page