(data stored in ACNUC7421 zone)

EMBL: CP001825.PE233

CP001825.PE233       Location/Qualifiers
FT   CDS             254462..254902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0235"
FT                   /product="CcmE/CycJ protein"
FT                   /note="PFAM: CcmE/CycJ protein; KEGG: dds:Ddes_2369
FT                   cytochrome c-type biogenesis protein CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41157"
FT                   /db_xref="GOA:D1CC97"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/TrEMBL:D1CC97"
FT                   /inference="protein motif:PFAM:PF03100"
FT                   /protein_id="ACZ41157.1"
FT                   /translation="MWYTAKGMAQAVAVDTTRRRNLGLLVVGLVAAAAILYLVVSNFSA
FT                   NTVYYLKVSELQSSYHGGQVRVSGKVLPGSISRQGDKLSFTAYDGSGRMRVEYQGVVPD
FT                   IFKDNADVVVEGTYDGQVFHAHTLLAKCPSKFQSKPSQGYAQ"
     MWYTAKGMAQ AVAVDTTRRR NLGLLVVGLV AAAAILYLVV SNFSANTVYY LKVSELQSSY        60
     HGGQVRVSGK VLPGSISRQG DKLSFTAYDG SGRMRVEYQG VVPDIFKDNA DVVVEGTYDG       120
     QVFHAHTLLA KCPSKFQSKP SQGYAQ                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page