(data stored in ACNUC7421 zone)

EMBL: CP001825.PE234

CP001825.PE234       Location/Qualifiers
FT   CDS             254940..255683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0236"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sus:Acid_4236 heme exporter protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41158"
FT                   /db_xref="GOA:D1CE02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE02"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ41158.1"
FT                   /translation="MFSNKPSQSMSDPVPVIEAQGIGKLYNRRWALRNVNIKVFAGERV
FT                   LLWGPNGSGKTSLLRILATLSRASRGELKLFGLEAIKYKRDLRNRIGYLGHNLTLYDDL
FT                   TARENLNLYSKLYSVKNPENLYMPLIYTFGLVSFLDSRVRNYSRGMQQKLAIVKALIHQ
FT                   PEILLLDEPSTGLDAESTHKLEEVLAQYDGTIVFSSHDLEFGLSVGNRVLVLSNGSIIA
FT                   DKSVQEIDSIDLQHPTQRHKLTIQP"
     MFSNKPSQSM SDPVPVIEAQ GIGKLYNRRW ALRNVNIKVF AGERVLLWGP NGSGKTSLLR        60
     ILATLSRASR GELKLFGLEA IKYKRDLRNR IGYLGHNLTL YDDLTARENL NLYSKLYSVK       120
     NPENLYMPLI YTFGLVSFLD SRVRNYSRGM QQKLAIVKAL IHQPEILLLD EPSTGLDAES       180
     THKLEEVLAQ YDGTIVFSSH DLEFGLSVGN RVLVLSNGSI IADKSVQEID SIDLQHPTQR       240
     HKLTIQP                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page