(data stored in ACNUC7421 zone)

EMBL: CP001825.PE236

CP001825.PE236       Location/Qualifiers
FT   CDS             256356..257075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0238"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   aba:Acid345_2302 cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41160"
FT                   /db_xref="GOA:D1CE04"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE04"
FT                   /inference="protein motif:PFAM:PF01578"
FT                   /protein_id="ACZ41160.1"
FT                   /translation="MAQITAAVQSTRYYGWVDKLSQVLAFVTLPLMALTLYMTLIYAPT
FT                   DATQGDVQRIFYYHVPTAWNGFLAFFLVFVASVVYLFKSSRFWDALARASAEVGLVFTT
FT                   IMIITGSLWGKPVWGTWWSWDPRMTTTLILWFIYLGYLMLRAYAPSKQQGARYAAVLGI
FT                   VGFVDVPIVYMSTKWWRTLHPQQVVEPGQVSMPPEMLQAFMVSLLAFTLLFIWILIIRT
FT                   RIALIEDELEIRSIENG"
     MAQITAAVQS TRYYGWVDKL SQVLAFVTLP LMALTLYMTL IYAPTDATQG DVQRIFYYHV        60
     PTAWNGFLAF FLVFVASVVY LFKSSRFWDA LARASAEVGL VFTTIMIITG SLWGKPVWGT       120
     WWSWDPRMTT TLILWFIYLG YLMLRAYAPS KQQGARYAAV LGIVGFVDVP IVYMSTKWWR       180
     TLHPQQVVEP GQVSMPPEML QAFMVSLLAF TLLFIWILII RTRIALIEDE LEIRSIENG        239
//

If you have problems or comments...

PBIL Back to PBIL home page