(data stored in ACNUC7421 zone)

EMBL: CP001825.PE239

CP001825.PE239       Location/Qualifiers
FT   CDS             257834..258766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0241"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   pzu:PHZ_c1916 probable periplasmic substrate- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41163"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE07"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACZ41163.1"
FT                   /translation="MRIVSLLPSATEIVCSLGLIDSLVGVTHECDYPPEVMGKPILTRS
FT                   LIDTTQDSYSIDRQVVESLHEHRTLYALDEELLRELSPDLILTQELCDVCAVSYTVVEK
FT                   AARILPAETPVVSLEPNTLYDILETILLVGRLTGTEARAQKLIDELITRIRAVESKASS
FT                   VAHKPKVYCMEWVNPPYKSGHWIPEMVRIAGGEEVFGLEGIPSSRASWEEIAQAAPEVV
FT                   VVMACGFDADRTERELMLINEREEWQSLPAVRNGNVWVSNGSAYFARPGPRIVDSLEML
FT                   AHAIHPELFPEPDRTQFRRFRPLAAASLV"
     MRIVSLLPSA TEIVCSLGLI DSLVGVTHEC DYPPEVMGKP ILTRSLIDTT QDSYSIDRQV        60
     VESLHEHRTL YALDEELLRE LSPDLILTQE LCDVCAVSYT VVEKAARILP AETPVVSLEP       120
     NTLYDILETI LLVGRLTGTE ARAQKLIDEL ITRIRAVESK ASSVAHKPKV YCMEWVNPPY       180
     KSGHWIPEMV RIAGGEEVFG LEGIPSSRAS WEEIAQAAPE VVVVMACGFD ADRTERELML       240
     INEREEWQSL PAVRNGNVWV SNGSAYFARP GPRIVDSLEM LAHAIHPELF PEPDRTQFRR       300
     FRPLAAASLV                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page