(data stored in ACNUC7421 zone)

EMBL: CP001825.PE24

CP001825.PE24        Location/Qualifiers
FT   CDS             complement(25480..26640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0025"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   KEGG: bar:GBAA0004 recombination protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40948"
FT                   /db_xref="GOA:D1CDE2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE2"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACZ40948.1"
FT                   /translation="MPNGPILVLGPNASGKTTLLEAIYLLATTKSHRAGSDRELINWNT
FT                   ESEEGVPAFARVAAEVRRRSPIQVEITILKESTAQGENVRKRIRVNGVNKRAIDLIGQV
FT                   NVVMFGPQDLDLIVGAPSLRRRYLNITISQLDHQYVRTLQTYERVVLQRNTLIKALSDR
FT                   AFKLRDESINDQFAYWDNELVNQGSYLLARRLEILSRMNELASMVHSKLTGSSQELSIA
FT                   YKSTLFDSLPLQLDNPREEEIRDLYIKKIHDLRREELRRGMTLVGPHRDDISFLVGGVD
FT                   VGVYGSRGQQRSVILAIKLAEVDLMKSITGDLPILLLDDVVSELDPERRRYLLQNVLQL
FT                   SQQALVTTTDLLTIGREFLAEASLFETTSTGLLQPMKRTWKIGGER"
     MPNGPILVLG PNASGKTTLL EAIYLLATTK SHRAGSDREL INWNTESEEG VPAFARVAAE        60
     VRRRSPIQVE ITILKESTAQ GENVRKRIRV NGVNKRAIDL IGQVNVVMFG PQDLDLIVGA       120
     PSLRRRYLNI TISQLDHQYV RTLQTYERVV LQRNTLIKAL SDRAFKLRDE SINDQFAYWD       180
     NELVNQGSYL LARRLEILSR MNELASMVHS KLTGSSQELS IAYKSTLFDS LPLQLDNPRE       240
     EEIRDLYIKK IHDLRREELR RGMTLVGPHR DDISFLVGGV DVGVYGSRGQ QRSVILAIKL       300
     AEVDLMKSIT GDLPILLLDD VVSELDPERR RYLLQNVLQL SQQALVTTTD LLTIGREFLA       360
     EASLFETTST GLLQPMKRTW KIGGER                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page