(data stored in ACNUC7421 zone)

EMBL: CP001825.PE242

CP001825.PE242       Location/Qualifiers
FT   CDS             259790..261304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0244"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="KEGG: gur:Gura_3250 4-alpha-glucanotransferase;
FT                   TIGRFAM: 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41166"
FT                   /db_xref="GOA:D1CE10"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE10"
FT                   /inference="protein motif:TFAM:TIGR00217"
FT                   /protein_id="ACZ41166.1"
FT                   /translation="MNDHRRSGVLLHLTSIPTKYSIGDMGPKAYEFLDFITSSGLSIWQ
FT                   MLPVGPVGKSNSPYQSYSAFAGNHLLISPDLLLEEGILATADLPKEPNTKHQRTDYALA
FT                   RRIKSLILQKAFSRFTPTKDFESFCEEYSYWLDDYAMFMTLLELNNGRPWNLWHTDISR
FT                   RDKTTLERLSREHKQRIMFHKFAQYLFFKQWFELKKACNSRGVKILGDLPIFVAHNSAD
FT                   VWAHPEIFKLKPDGNPRMIAGVPPDYFSSTGQLWGNPLYDWQMLEAQNYSWWIDRLKWS
FT                   LKLFDMVRIDHFRGFCACWEVPYGETTAVNGRWVKVPGAKFFRTAIKALGSLPVIAEDL
FT                   GVITPEVEALRDKFGFPGMKVLQFAFTNPQNQYLPHNYVTFNCVVYTGTHDNNTTLGWW
FT                   EELDSKHKSIVRSYVGRKTGKDLVWELIRMGISSTAKYAIFPLQDFLTLGSEARMNIPG
FT                   TEFGNWEWSYPESALSEEIAGRIKHLCKLYNRVPPEEKEQQITNPQ"
     MNDHRRSGVL LHLTSIPTKY SIGDMGPKAY EFLDFITSSG LSIWQMLPVG PVGKSNSPYQ        60
     SYSAFAGNHL LISPDLLLEE GILATADLPK EPNTKHQRTD YALARRIKSL ILQKAFSRFT       120
     PTKDFESFCE EYSYWLDDYA MFMTLLELNN GRPWNLWHTD ISRRDKTTLE RLSREHKQRI       180
     MFHKFAQYLF FKQWFELKKA CNSRGVKILG DLPIFVAHNS ADVWAHPEIF KLKPDGNPRM       240
     IAGVPPDYFS STGQLWGNPL YDWQMLEAQN YSWWIDRLKW SLKLFDMVRI DHFRGFCACW       300
     EVPYGETTAV NGRWVKVPGA KFFRTAIKAL GSLPVIAEDL GVITPEVEAL RDKFGFPGMK       360
     VLQFAFTNPQ NQYLPHNYVT FNCVVYTGTH DNNTTLGWWE ELDSKHKSIV RSYVGRKTGK       420
     DLVWELIRMG ISSTAKYAIF PLQDFLTLGS EARMNIPGTE FGNWEWSYPE SALSEEIAGR       480
     IKHLCKLYNR VPPEEKEQQI TNPQ                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page