(data stored in ACNUC7421 zone)

EMBL: CP001825.PE251

CP001825.PE251       Location/Qualifiers
FT   CDS             complement(268374..269456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0253"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; Methyltransferase type
FT                   11; KEGG: THUMPD3; THUMP domain containing 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41175"
FT                   /db_xref="GOA:D1CE19"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE19"
FT                   /inference="protein motif:PFAM:PF01170"
FT                   /protein_id="ACZ41175.1"
FT                   /translation="MKRERSKPSKLKPAPIQNVFYEVEFVPGLEPFVLEELHEKLVNLE
FT                   EIYPYVKSGNFQFNFYGDPRQLLKLRSVGSAFVVKLFEVPRPLALLGHQNFSQLLTLIE
FT                   SVLSLHPEGSFKTFRISAAGSDSPVFRRIYKELELSTGLIPSQDGDLFLRVRKPIVRGD
FT                   GFEVSIRLTPRPLSVRPWRVCDFPGAINSTVAYVMARLSEPSAGDVIVNLGCGSGTILI
FT                   ERLEMLPAKAVVGVDIDPEALACARRNVYAAGLTGKVDLLRGDMRSTGLNSGFADVIYA
FT                   DLPFGHILGSHADNIHLYPDTLKESARIAREGARGIFITSEIRLMRKVIDLCKHLWRQE
FT                   GEVRLEMDKLRLMIFVLSRL"
     MKRERSKPSK LKPAPIQNVF YEVEFVPGLE PFVLEELHEK LVNLEEIYPY VKSGNFQFNF        60
     YGDPRQLLKL RSVGSAFVVK LFEVPRPLAL LGHQNFSQLL TLIESVLSLH PEGSFKTFRI       120
     SAAGSDSPVF RRIYKELELS TGLIPSQDGD LFLRVRKPIV RGDGFEVSIR LTPRPLSVRP       180
     WRVCDFPGAI NSTVAYVMAR LSEPSAGDVI VNLGCGSGTI LIERLEMLPA KAVVGVDIDP       240
     EALACARRNV YAAGLTGKVD LLRGDMRSTG LNSGFADVIY ADLPFGHILG SHADNIHLYP       300
     DTLKESARIA REGARGIFIT SEIRLMRKVI DLCKHLWRQE GEVRLEMDKL RLMIFVLSRL       360
//

If you have problems or comments...

PBIL Back to PBIL home page