(data stored in ACNUC7421 zone)

EMBL: CP001825.PE252

CP001825.PE252       Location/Qualifiers
FT   CDS             complement(269580..270092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0254"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; Ferritin Dps family protein;
FT                   KEGG: nis:NIS_1151 bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41176"
FT                   /db_xref="GOA:D1CE20"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE20"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ACZ41176.1"
FT                   /translation="MAMHTTSSHSIYAEENAAKREKIIQLLTKAYWMEIESVMNYITNS
FT                   VNPDGVRAREITEALSQDIQEELGHAQMFASRIKELYGVVPGSMDFKPEQSYLQPPENQ
FT                   TDIVHVIKGVIEAEKGAIEFYTQILHETEEVDLVTQDMVIDILHDEQGHLRLFEGFLRE
FT                   YEAEGKA"
     MAMHTTSSHS IYAEENAAKR EKIIQLLTKA YWMEIESVMN YITNSVNPDG VRAREITEAL        60
     SQDIQEELGH AQMFASRIKE LYGVVPGSMD FKPEQSYLQP PENQTDIVHV IKGVIEAEKG       120
     AIEFYTQILH ETEEVDLVTQ DMVIDILHDE QGHLRLFEGF LREYEAEGKA                  170
//

If you have problems or comments...

PBIL Back to PBIL home page