(data stored in ACNUC7421 zone)

EMBL: CP001825.PE257

CP001825.PE257       Location/Qualifiers
FT   CDS             274979..276103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0259"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; CBS domain containing protein;
FT                   SMART: CBS domain containing protein; KEGG: sfu:Sfum_2488
FT                   peptidase M50"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41181"
FT                   /db_xref="GOA:D1CE25"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE25"
FT                   /inference="protein motif:PFAM:PF02163"
FT                   /protein_id="ACZ41181.1"
FT                   /translation="MSMNPLSGFRLCKIFGIPIYVNPTWFLVFALIVYSLASDRLPEFI
FT                   PGSSNLFYWLAAIVGTLLFFLSLTAHELGHSLVSKSFGIPVRSITLHMFGGIAQLGSEV
FT                   RRAREEFWIAIAGPIVSFALFLTFWGLSDIITSSMPAIGSFLSLLALLNIGVALFNLFP
FT                   GFPLDGGRILRSIVWGISGNYIRATRISALGGQLFGYLLIAAGVLFAILDRYLGYLWMV
FT                   LLGAFIIILARQSYRQSLTYHKLSNIKLADVYIPLVHVEEDTLVSDLFTDYIRSSGRQF
FT                   FIVDFHGEPVGLLTPYEILRLPQPFWHITPVRSIMINLASVGRLPADLSLFDAMNLFER
FT                   TGHNLFLVIDDDRIEGIVTRDTVVHVLGRTTSRV"
     MSMNPLSGFR LCKIFGIPIY VNPTWFLVFA LIVYSLASDR LPEFIPGSSN LFYWLAAIVG        60
     TLLFFLSLTA HELGHSLVSK SFGIPVRSIT LHMFGGIAQL GSEVRRAREE FWIAIAGPIV       120
     SFALFLTFWG LSDIITSSMP AIGSFLSLLA LLNIGVALFN LFPGFPLDGG RILRSIVWGI       180
     SGNYIRATRI SALGGQLFGY LLIAAGVLFA ILDRYLGYLW MVLLGAFIII LARQSYRQSL       240
     TYHKLSNIKL ADVYIPLVHV EEDTLVSDLF TDYIRSSGRQ FFIVDFHGEP VGLLTPYEIL       300
     RLPQPFWHIT PVRSIMINLA SVGRLPADLS LFDAMNLFER TGHNLFLVID DDRIEGIVTR       360
     DTVVHVLGRT TSRV                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page