(data stored in ACNUC7421 zone)

EMBL: CP001825.PE26

CP001825.PE26        Location/Qualifiers
FT   CDS             complement(27108..29180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0027"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="KEGG: Os02g0603800; hypothetical protein; K03526 4-
FT                   hydroxy-3-methylbut-2-en-1-yl diphosphate synthase;
FT                   TIGRFAM: 1-hydroxy-2-methyl-2-(E)-butenyl 4- diphosphate
FT                   synthase; PFAM: IspG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40950"
FT                   /db_xref="GOA:D1CDE4"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017178"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE4"
FT                   /inference="protein motif:TFAM:TIGR00612"
FT                   /protein_id="ACZ40950.1"
FT                   /translation="MVKSQEVTSNRYCVDPYSYKRRCTHEVMVGNVGVGGNNPIRVQSM
FT                   TTTRTKDVESTVNQIVSLARVGCEIVRVTTPTPADARAIKDIKKELQSKNIHIPIVADV
FT                   HFSPHAAMEAALWADKVRINPGNFADTKLFHIKEYTDEEYAKHLEKIAEKLYPLVMRCK
FT                   ERGISMRIGTNHGSLSDRIMSRYGDTPLGMVESALEFVRMCEEWGYKDIILSMKASNPK
FT                   VMIAAYRLLAARMLEYGMTYPFHLGVTEAGNGEDGRIKSAIGIGTLLEDGIGDTVRVSL
FT                   TEDPENEIPFAYELVKRYAYGIVPDSDEATSIDPLPDLRSPFDYSPRPTRKIFLGEHVL
FT                   GANNPPLVLYKQSSPLSINGVVSINRPVGRDSLRADALSLEVVSEKDRDVFQTSASGLQ
FT                   FASNKPALIATLRFPVDVRDIEAAAYMCSIERGQEDRLSTVARLAVEHKRPLVLELIAN
FT                   IAHDQARDLEGKHDYSVVDELISYALKVEQFGVNDLILALRIPDRSYRIRAYRLLDSRL
FT                   RELGKDWNLLLTVTEDDLIDASIGLGSLLCDGIGSMVSIEGNKPYEEKISLVFNILQAS
FT                   GARISKAEFIACPSCGRTLFDLQTTTEKIKSKTGHLKGVKIAVMGCIVNGLGELADADF
FT                   GYMGSGEGKVNLFVGKTCVEKNVPEEIAADKLVDLIKAHGRWIDPPDNNSSMHDS"
     MVKSQEVTSN RYCVDPYSYK RRCTHEVMVG NVGVGGNNPI RVQSMTTTRT KDVESTVNQI        60
     VSLARVGCEI VRVTTPTPAD ARAIKDIKKE LQSKNIHIPI VADVHFSPHA AMEAALWADK       120
     VRINPGNFAD TKLFHIKEYT DEEYAKHLEK IAEKLYPLVM RCKERGISMR IGTNHGSLSD       180
     RIMSRYGDTP LGMVESALEF VRMCEEWGYK DIILSMKASN PKVMIAAYRL LAARMLEYGM       240
     TYPFHLGVTE AGNGEDGRIK SAIGIGTLLE DGIGDTVRVS LTEDPENEIP FAYELVKRYA       300
     YGIVPDSDEA TSIDPLPDLR SPFDYSPRPT RKIFLGEHVL GANNPPLVLY KQSSPLSING       360
     VVSINRPVGR DSLRADALSL EVVSEKDRDV FQTSASGLQF ASNKPALIAT LRFPVDVRDI       420
     EAAAYMCSIE RGQEDRLSTV ARLAVEHKRP LVLELIANIA HDQARDLEGK HDYSVVDELI       480
     SYALKVEQFG VNDLILALRI PDRSYRIRAY RLLDSRLREL GKDWNLLLTV TEDDLIDASI       540
     GLGSLLCDGI GSMVSIEGNK PYEEKISLVF NILQASGARI SKAEFIACPS CGRTLFDLQT       600
     TTEKIKSKTG HLKGVKIAVM GCIVNGLGEL ADADFGYMGS GEGKVNLFVG KTCVEKNVPE       660
     EIAADKLVDL IKAHGRWIDP PDNNSSMHDS                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page