(data stored in ACNUC7421 zone)

EMBL: CP001825.PE263

CP001825.PE263       Location/Qualifiers
FT   CDS             281011..282543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0265"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bha:BH1864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41187"
FT                   /db_xref="GOA:D1CE31"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE31"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACZ41187.1"
FT                   /translation="MPKLTNWYTKYKFPVLFVYLMIVALIIAACGGGAGSNTPTASQPA
FT                   ASTGEMGASNTPVPTIVATPPAIARQATGVPDIQCKPDQKQLVWMVRNGPVENQWEANI
FT                   VRPEFQKAHPEICLKILSINQDDIAVKRQAMIAAGEPLHVWSPNWGGDGFASDRIRGLI
FT                   ADLTPLIQRDNFDLSVFDPNVLKIYQIDGKTWALPFLTTGSFVYYNKELFDKAGVPYPP
FT                   TSWDDTSWTWDKFIATAKKLTKNTNNLNKAQFGAANGLWPPVDAIGALWGYWIIPDEAQ
FT                   QTGFSDGVQVVNDRTIKAFQAMHDLVYKDKVAPNNAAVSALTQLGGVFESGRVAMFMTG
FT                   GWGHWSYHPLIDDPNGFCWGAAPLPMGTPDAKRRAVLFTDPWVITANLSPEEQDLAWTF
FT                   IKFLVSEDQARKYMEATGTPPTQTKLMQEYYKQFSKCMKPEDMKEVFEGAFSHGRESSN
FT                   HLLVKFDELNQIWDNGLATFWNNPNAKAEDVLKKIEPQFNSALKRIKAEEGQ"
     MPKLTNWYTK YKFPVLFVYL MIVALIIAAC GGGAGSNTPT ASQPAASTGE MGASNTPVPT        60
     IVATPPAIAR QATGVPDIQC KPDQKQLVWM VRNGPVENQW EANIVRPEFQ KAHPEICLKI       120
     LSINQDDIAV KRQAMIAAGE PLHVWSPNWG GDGFASDRIR GLIADLTPLI QRDNFDLSVF       180
     DPNVLKIYQI DGKTWALPFL TTGSFVYYNK ELFDKAGVPY PPTSWDDTSW TWDKFIATAK       240
     KLTKNTNNLN KAQFGAANGL WPPVDAIGAL WGYWIIPDEA QQTGFSDGVQ VVNDRTIKAF       300
     QAMHDLVYKD KVAPNNAAVS ALTQLGGVFE SGRVAMFMTG GWGHWSYHPL IDDPNGFCWG       360
     AAPLPMGTPD AKRRAVLFTD PWVITANLSP EEQDLAWTFI KFLVSEDQAR KYMEATGTPP       420
     TQTKLMQEYY KQFSKCMKPE DMKEVFEGAF SHGRESSNHL LVKFDELNQI WDNGLATFWN       480
     NPNAKAEDVL KKIEPQFNSA LKRIKAEEGQ                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page