(data stored in ACNUC7421 zone)

EMBL: CP001825.PE264

CP001825.PE264       Location/Qualifiers
FT   CDS             282639..284888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0266"
FT                   /product="Spermine synthase"
FT                   /note="PFAM: Spermine synthase; KEGG: ade:Adeh_3062
FT                   spermine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41188"
FT                   /db_xref="GOA:D1CE32"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE32"
FT                   /inference="protein motif:PFAM:PF01564"
FT                   /protein_id="ACZ41188.1"
FT                   /translation="MRIKVRGIILIMFFMSGVTSLIYEVSWFRQLSLTLGVSAYSAAAV
FT                   VSAFMGGLALGGWLGSKIIKRVDAIKFYACLQLLIACCAFLTPVVFKFMPSIYTSLYNE
FT                   YNPDFYLFNLLRFGLACMVLLWPTTLIGMTFPAVSQAYTIYNQRGKDLGSLYSVNAIGS
FT                   VLGALLSGLVLIRLLGTRDTILISGIIDLMLAALAFAISSRIVKQNKDLRTLQANPQNI
FT                   DLYPKRLVNIAFWGFALSGFVSLGYEVVWFRILSNFTLNSVYSFTVLLSIFILGLSIGS
FT                   FLASRLVDSAKSPISAFAIIQLGIGVSAVLSLYVFHRLPTILLRIGLPSSALQEITIEV
FT                   IAAALTIFVPTVLIGATFPLAARIYTNSNVYKIGNPAGKLYGANTVFSMIGSLVAGFLL
FT                   IPTMGLQKSVLMLALVNILIGIAALLQISDPPKIEAYALLGTAAIGALLLPQGVFLGFR
FT                   EGTNPYLVYYKEGVDANVSVFIVPNPPLKISFVNGRNEVPTDRYSMRAFYLMGHLPALL
FT                   KPDAKSALVLSFGNGIATGALSRHKIQHIDAVEIVAQQVEAARFYQPENRNVLSYPGLN
FT                   ITIEDARNYLLRSDKKYDIITADATHPTNSSSWAMFTQEFYKLARSHLSPDGVMVQWLP
FT                   IHDISKEDYISIIKTFQSVFPHTTLWYVGSTHTLLVATPHKLSTQEVLALDSLIDKRGI
FT                   RDDLIDSRTLVSNYLMNEDQVRKYSSSGSIVTDDKAFFLPAMDDGVILQSFQLAK"
     MRIKVRGIIL IMFFMSGVTS LIYEVSWFRQ LSLTLGVSAY SAAAVVSAFM GGLALGGWLG        60
     SKIIKRVDAI KFYACLQLLI ACCAFLTPVV FKFMPSIYTS LYNEYNPDFY LFNLLRFGLA       120
     CMVLLWPTTL IGMTFPAVSQ AYTIYNQRGK DLGSLYSVNA IGSVLGALLS GLVLIRLLGT       180
     RDTILISGII DLMLAALAFA ISSRIVKQNK DLRTLQANPQ NIDLYPKRLV NIAFWGFALS       240
     GFVSLGYEVV WFRILSNFTL NSVYSFTVLL SIFILGLSIG SFLASRLVDS AKSPISAFAI       300
     IQLGIGVSAV LSLYVFHRLP TILLRIGLPS SALQEITIEV IAAALTIFVP TVLIGATFPL       360
     AARIYTNSNV YKIGNPAGKL YGANTVFSMI GSLVAGFLLI PTMGLQKSVL MLALVNILIG       420
     IAALLQISDP PKIEAYALLG TAAIGALLLP QGVFLGFREG TNPYLVYYKE GVDANVSVFI       480
     VPNPPLKISF VNGRNEVPTD RYSMRAFYLM GHLPALLKPD AKSALVLSFG NGIATGALSR       540
     HKIQHIDAVE IVAQQVEAAR FYQPENRNVL SYPGLNITIE DARNYLLRSD KKYDIITADA       600
     THPTNSSSWA MFTQEFYKLA RSHLSPDGVM VQWLPIHDIS KEDYISIIKT FQSVFPHTTL       660
     WYVGSTHTLL VATPHKLSTQ EVLALDSLID KRGIRDDLID SRTLVSNYLM NEDQVRKYSS       720
     SGSIVTDDKA FFLPAMDDGV ILQSFQLAK                                         749
//

If you have problems or comments...

PBIL Back to PBIL home page