(data stored in ACNUC7421 zone)

EMBL: CP001825.PE265

CP001825.PE265       Location/Qualifiers
FT   CDS             complement(284958..286286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0267"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bxe:Bxe_C1347 putative mandelate
FT                   racemase/muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41189"
FT                   /db_xref="GOA:D1CE33"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE33"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACZ41189.1"
FT                   /translation="MSVTITDIETYDIRFPTSRNLDGSDAMNPSPDYSAAYVILKTDSP
FT                   DGLEGHGLAFTIGRGNEIVVSAIQALSYLIRGLTLEYITSDMGTFWYRLVGDSQLRWIG
FT                   PEKGAIHLGLAALVNAVWDLYAKAEGKPLWKLLVDMTPEQIVSCVPFRYIRDVLTPQEA
FT                   LEILKSNEPTKHIREREMLERGFPAYTTSAGWLGYSDDKLAALCRRCVEEGWSHFKMKV
FT                   GANLEDDIRRASLIRDIIGYDCALMMDANQVWDVDQAISWMKELSKFNPVWIEEPTSPD
FT                   DILGHARIAREIAPVGVATGEHCHNRVMFKQFMQANAIDYCQVDACRLGGVNEVLAVLL
FT                   MAAKFGIPVCPHAGGVGLCEYVQHISIFDYIYVSASLENRVLEYVDHLHEHFVDPVVIR
FT                   NGNYMPPTSPGYSITMKKESLEQYQYPTGIVWSLSESQSRKTM"
     MSVTITDIET YDIRFPTSRN LDGSDAMNPS PDYSAAYVIL KTDSPDGLEG HGLAFTIGRG        60
     NEIVVSAIQA LSYLIRGLTL EYITSDMGTF WYRLVGDSQL RWIGPEKGAI HLGLAALVNA       120
     VWDLYAKAEG KPLWKLLVDM TPEQIVSCVP FRYIRDVLTP QEALEILKSN EPTKHIRERE       180
     MLERGFPAYT TSAGWLGYSD DKLAALCRRC VEEGWSHFKM KVGANLEDDI RRASLIRDII       240
     GYDCALMMDA NQVWDVDQAI SWMKELSKFN PVWIEEPTSP DDILGHARIA REIAPVGVAT       300
     GEHCHNRVMF KQFMQANAID YCQVDACRLG GVNEVLAVLL MAAKFGIPVC PHAGGVGLCE       360
     YVQHISIFDY IYVSASLENR VLEYVDHLHE HFVDPVVIRN GNYMPPTSPG YSITMKKESL       420
     EQYQYPTGIV WSLSESQSRK TM                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page