(data stored in ACNUC7421 zone)

EMBL: CP001825.PE266

CP001825.PE266       Location/Qualifiers
FT   CDS             complement(286336..287088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0268"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bbr:BB1748 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41190"
FT                   /db_xref="GOA:D1CE34"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE34"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACZ41190.1"
FT                   /translation="MRLEGKRAIVTGAGSGIGKAIASRFAQEGARVVIADIDLEAAEIV
FT                   AKELGDNTKPYRVDVSKAEEVHKLINHVVDEWGGLDIMVNNAGVGVAATTTETSEEDFD
FT                   RIIAINLKGTFLGMKYAIPAIRNSGGGSIINIASVAGLVGVPERAAYCASKGGIVALTR
FT                   AAAIDHISEGVRINCICPGTVLTPWIERITANYPDPEAARAAMEARQPHGRFVMPEEIA
FT                   AMAAFLASDEAGSIVGAAMVVDGGMTAK"
     MRLEGKRAIV TGAGSGIGKA IASRFAQEGA RVVIADIDLE AAEIVAKELG DNTKPYRVDV        60
     SKAEEVHKLI NHVVDEWGGL DIMVNNAGVG VAATTTETSE EDFDRIIAIN LKGTFLGMKY       120
     AIPAIRNSGG GSIINIASVA GLVGVPERAA YCASKGGIVA LTRAAAIDHI SEGVRINCIC       180
     PGTVLTPWIE RITANYPDPE AARAAMEARQ PHGRFVMPEE IAAMAAFLAS DEAGSIVGAA       240
     MVVDGGMTAK                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page