(data stored in ACNUC7421 zone)

EMBL: CP001825.PE27

CP001825.PE27        Location/Qualifiers
FT   CDS             29352..30197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0028"
FT                   /product="thymidylate synthase, flavin-dependent"
FT                   /EC_number="2.1.1.148"
FT                   /note="KEGG: afw:Anae109_1187 thymidylate synthase, flavin-
FT                   dependent; TIGRFAM: thymidylate synthase, flavin-dependent;
FT                   PFAM: thymidylate synthase complementing protein ThyX"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40951"
FT                   /db_xref="GOA:D1CDE5"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDE5"
FT                   /inference="protein motif:TFAM:TIGR02170"
FT                   /protein_id="ACZ40951.1"
FT                   /translation="MAQQSTNNGIALTRGEKTNIKVKLLFPTKEIAEQYYLPIAYTAAR
FT                   TCYSEKYPEDIWEDALSGKIPQEKMQKLIESIIESGHGTVIEHLWFTFAISGVSRSLSH
FT                   QLVRHRMGVSFDQQSQRYVRYKHPQYTVPESIAEDSELLEKFVQAIEGNMELYSEMLSQ
FT                   GVPAEDARFLFPNGIQTNLVMTVNLRELIHMSGLRLCTMAQWEIRKLFALIKAEVRRTH
FT                   PFLAQFLVIKCVRMGYCDEARNADEHCKVRPHKNTVFKLIDEYRHSQRTNSTRAQNTNE
FT                   "
     MAQQSTNNGI ALTRGEKTNI KVKLLFPTKE IAEQYYLPIA YTAARTCYSE KYPEDIWEDA        60
     LSGKIPQEKM QKLIESIIES GHGTVIEHLW FTFAISGVSR SLSHQLVRHR MGVSFDQQSQ       120
     RYVRYKHPQY TVPESIAEDS ELLEKFVQAI EGNMELYSEM LSQGVPAEDA RFLFPNGIQT       180
     NLVMTVNLRE LIHMSGLRLC TMAQWEIRKL FALIKAEVRR THPFLAQFLV IKCVRMGYCD       240
     EARNADEHCK VRPHKNTVFK LIDEYRHSQR TNSTRAQNTN E                           281
//

If you have problems or comments...

PBIL Back to PBIL home page