(data stored in ACNUC7421 zone)

EMBL: CP001825.PE270

CP001825.PE270       Location/Qualifiers
FT   CDS             290193..291161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0272"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: ret:RHE_CH00494
FT                   L-fucose dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41194"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE38"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACZ41194.1"
FT                   /translation="MEKQQTLPLRPLGSTGLQVTPICVGCAELGNMPETFAYSVEEEIA
FT                   LQTIREAFKSPINFMDTAAAYGDGESERRIGIVIREMGGLPPNYVLATKADRNLQTGDF
FT                   SGEQIKRSIERSLNLLGLDKLQLVYLHDPEHSTFEYITSKGGAIDTLVAYKDQGVIEHI
FT                   GIAGGPIDMMIRYVELDVFEAVITHNRYTLINRSAEPLIDLAHKKGLAVVNAAPYGSGI
FT                   LAKGPDAYPRYAYQEAPDKILNRVRVIDEVCKRYGVPIAAVALHFSLRDPRITSTIVGM
FT                   SKPERIRQTIDLVNTHIPAGVWEELEPLDYDTEDPEANRWK"
     MEKQQTLPLR PLGSTGLQVT PICVGCAELG NMPETFAYSV EEEIALQTIR EAFKSPINFM        60
     DTAAAYGDGE SERRIGIVIR EMGGLPPNYV LATKADRNLQ TGDFSGEQIK RSIERSLNLL       120
     GLDKLQLVYL HDPEHSTFEY ITSKGGAIDT LVAYKDQGVI EHIGIAGGPI DMMIRYVELD       180
     VFEAVITHNR YTLINRSAEP LIDLAHKKGL AVVNAAPYGS GILAKGPDAY PRYAYQEAPD       240
     KILNRVRVID EVCKRYGVPI AAVALHFSLR DPRITSTIVG MSKPERIRQT IDLVNTHIPA       300
     GVWEELEPLD YDTEDPEANR WK                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page