(data stored in ACNUC7421 zone)

EMBL: CP001825.PE271

CP001825.PE271       Location/Qualifiers
FT   CDS             291217..292053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0273"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sus:Acid_1947 xylose isomerase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41195"
FT                   /db_xref="GOA:D1CE39"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE39"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACZ41195.1"
FT                   /translation="MNNRISCHLITWGNDLLTGMKEASELGFQACETFTHQALEYENRV
FT                   EEFRELLGSYDLELSALYGGGRFSDPSKEAEVIAYNTRVAQFLSKLGVDRIVFGPGGPR
FT                   EGKTSLEGLKQMAKTINEAAKRTYDLGVLACVHPHLGTELQDEDELDAVMEMTDDRYVF
FT                   FCPDTAHLTAAGMNAAEIIRRYGNRMRYMHLKDLTPENPDPSVFTAFSGTEALPIFCEL
FT                   GLGTIDFVPIMQALQDVGYDGWLTVEIDQSTSTPYQSLKQCRDFVQDKLGISIRYR"
     MNNRISCHLI TWGNDLLTGM KEASELGFQA CETFTHQALE YENRVEEFRE LLGSYDLELS        60
     ALYGGGRFSD PSKEAEVIAY NTRVAQFLSK LGVDRIVFGP GGPREGKTSL EGLKQMAKTI       120
     NEAAKRTYDL GVLACVHPHL GTELQDEDEL DAVMEMTDDR YVFFCPDTAH LTAAGMNAAE       180
     IIRRYGNRMR YMHLKDLTPE NPDPSVFTAF SGTEALPIFC ELGLGTIDFV PIMQALQDVG       240
     YDGWLTVEID QSTSTPYQSL KQCRDFVQDK LGISIRYR                               278
//

If you have problems or comments...

PBIL Back to PBIL home page