(data stored in ACNUC7421 zone)

EMBL: CP001825.PE273

CP001825.PE273       Location/Qualifiers
FT   CDS             293351..294496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0275"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   aba:Acid345_3531 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41197"
FT                   /db_xref="GOA:D1CE41"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D1CE41"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACZ41197.1"
FT                   /translation="MFKQAGKSLRVAIYFMVFSVFCFVLSGCSVPGVAQVPPTPTPLPP
FT                   QPEVEKPIYTVKRGDIVELLRLTGRVSAVNEKDLQFTKSGNVLKVNVEVGDKVRKGQLL
FT                   AELDQSDLVKQLEQAQLELDQANLALQQYQNQHQTDVALAELDLQEAQLKLEAATSELD
FT                   RKLAEIAVKRAQIKLDQIKKATNEELQKQVAQARLNYERIKDQIDAGRIYAPFNGVVEI
FT                   VNIKPGDPVQPFQSVMTIMDPGEKEIRVDNTTSAELSQLSPHQKVQIRFLRYSDKVVSG
FT                   EIRMLPTGDQGSGGAIRISYNPDGLDVDIGDIANITVILQQKRNVLWLPPQAIRTFQGR
FT                   QFVVVQEGDRQRRVDVELGIQSQDKVEITSGLKEGQKVVGQ"
     MFKQAGKSLR VAIYFMVFSV FCFVLSGCSV PGVAQVPPTP TPLPPQPEVE KPIYTVKRGD        60
     IVELLRLTGR VSAVNEKDLQ FTKSGNVLKV NVEVGDKVRK GQLLAELDQS DLVKQLEQAQ       120
     LELDQANLAL QQYQNQHQTD VALAELDLQE AQLKLEAATS ELDRKLAEIA VKRAQIKLDQ       180
     IKKATNEELQ KQVAQARLNY ERIKDQIDAG RIYAPFNGVV EIVNIKPGDP VQPFQSVMTI       240
     MDPGEKEIRV DNTTSAELSQ LSPHQKVQIR FLRYSDKVVS GEIRMLPTGD QGSGGAIRIS       300
     YNPDGLDVDI GDIANITVIL QQKRNVLWLP PQAIRTFQGR QFVVVQEGDR QRRVDVELGI       360
     QSQDKVEITS GLKEGQKVVG Q                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page